TRIM17 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TRIM17 Antibody [NBP2-49156] - Staining of human cell line HaCaT shows localization to vesicles.

Immunohistochemistry: TRIM17 Antibody [NBP2-49156] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRIM17 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TRIM17 Antibody - BSA Free (NBP2-49156) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LDRQGHSLELLLLQLEERSTQGPLQMLQDMKEPLSRKNNVSVQCPEVAPPTRPRTVCRVPGQIEVLRGFLE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM17
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TRIM17 Recombinant Protein Antigen (NBP2-49156PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TRIM17 Antibody - BSA Free

• E3 ubiquitin-protein ligase TRIM17
• EC 6.3.2.-
• RBCCRNF16terf
• RING finger protein 16
• RING finger protein terf
• TERF
• Testis RING finger protein
• tripartite motif containing 17
• tripartite motif-containing 17
• Tripartite motif-containing protein 17

Background

TRIM17 is encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein is expressed almost exclusively in the testis, but its function is unknown. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRIM17