TRIM17 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TRIM17 Antibody [NBP2-49156] - Staining of human cell line HaCaT shows localization to vesicles.
Immunohistochemistry: TRIM17 Antibody [NBP2-49156] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIM17 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LDRQGHSLELLLLQLEERSTQGPLQMLQDMKEPLSRKNNVSVQCPEVAPPTRPRTVCRVPGQIEVLRGFLE
Specificity
Specificity of human TRIM17 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRIM17 Recombinant Protein Antigen (NBP2-49156PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIM17 Antibody

  • E3 ubiquitin-protein ligase TRIM17
  • EC 6.3.2.-
  • RBCCRNF16terf
  • RING finger protein 16
  • RING finger protein terf
  • TERF
  • Testis RING finger protein
  • tripartite motif containing 17
  • tripartite motif-containing 17
  • Tripartite motif-containing protein 17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-26612
Species: Hu
Applications: IP (-), WB
NB100-2596
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82787
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88301
Species: Hu
Applications: WB, IB
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-46214
Species: Hu
Applications: WB, IHC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1556
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49536
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-38536
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00055521-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for TRIM17 Antibody (NBP2-49156) (0)

There are no publications for TRIM17 Antibody (NBP2-49156).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM17 Antibody (NBP2-49156) (0)

There are no reviews for TRIM17 Antibody (NBP2-49156). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TRIM17 Antibody (NBP2-49156) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TRIM17 Antibody (NBP2-49156)

Discover related pathways, diseases and genes to TRIM17 Antibody (NBP2-49156). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM17 Antibody (NBP2-49156)

Discover more about diseases related to TRIM17 Antibody (NBP2-49156).
 

Pathways for TRIM17 Antibody (NBP2-49156)

View related products by pathway.

PTMs for TRIM17 Antibody (NBP2-49156)

Learn more about PTMs related to TRIM17 Antibody (NBP2-49156).
 

Research Areas for TRIM17 Antibody (NBP2-49156)

Find related products by research area.

Blogs on TRIM17

There are no specific blogs for TRIM17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM17 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM17