RBCK1 Antibody

Images

 
Western Blot: RBCK1 Antibody [NBP1-88301] - Analysis in human cell lines SK-MEL-30 and HeLa using Anti-RBCK1 antibody. Corresponding RBCK1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Immunohistochemistry-Paraffin: RBCK1 Antibody [NBP1-88301] - Staining of human small intestine shows strong cytoplasmic positivity in mucus containing glandular cells.
Western Blot: RBCK1 Antibody [NBP1-88301] - Analysis in human cell line HepG2.
Western Blot: RBCK1 Antibody [NBP1-88301] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
       

Orthogonal Strategies

 

Order Details

RBCK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBCK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunoblotting
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunoblotting reported in scientific literature (PMID 28103322).
Control Peptide
RBCK1 Protein (NBP1-88301PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-88301 in the following applications:

Publications
Read Publications using
NBP1-88301 in the following applications:

  • IB
    1 publication
  • WB
    5 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25640675).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBCK1 Antibody

  • C20orf18
  • EC 6.3.2.-
  • HBV associated factor 4
  • HBV-associated factor 4
  • Heme-oxidized IRP2 ubiquitin ligase 1
  • Hepatitis B virus X-associated protein 4
  • HOIL-1
  • RanBP-type and C3HC4-type zinc finger containing 1
  • ranBP-type and C3HC4-type zinc finger-containing protein 1
  • RBCC protein interacting with PKC1
  • RBCK2
  • RNF54RING finger protein 54
  • UBCE7IP3HOIL1
  • ubiquitin conjugating enzyme 7 interacting protein 3
  • Ubiquitin-conjugating enzyme 7-interacting protein 3
  • XAP3
  • XAP4chromosome 20 open reading frame 18
  • ZRANB4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF8039
Species: Hu
Applications: WB, IHC, ICC
AF8100
Species: Hu
Applications: WB, IHC
NBP2-49156
Species: Hu
Applications: ICC/IF, IHC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1798
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, GS
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-58069
Species: Hu
Applications: ICC/IF
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RBCK1 Antibody (NBP1-88301)(7)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IB, WB.


Filter By Application
IB
(1)
WB
(5)
All Applications
Filter By Species
Human
(6)
All Species
Showing Publications 1 - 7 of 7.
Publications using NBP1-88301 Applications Species
Polajnar M, Dietz MS, Heilemann M, Behrends C. Expanding the host cell ubiquitylation machinery targeting cytosolic Salmonella EMBO Rep. 2017 Aug 06 [PMID: 28784601] (Human) Human
Shibata Y, Tokunaga F, Goto E et al. HTLV-1 Tax Induces Formation of the Active Macromolecular IKK Complex by Generating Lys63- and Met1-Linked Hybrid Polyubiquitin Chains PLoS Pathog Jan 1 2017 [PMID: 28103322] (IB, Human) IB Human
Nakazawa S, Oikawa D, Ishii R et al. Linear ubiquitination is involved in the pathogenesis of optineurin-associated amyotrophic lateral sclerosis. Nat Commun. Aug 24 2016 [PMID: 27552911] (WB) WB
Klein T, Fung SY, Renner F et al. The paracaspase MALT1 cleaves HOIL1 reducing linear ubiquitination by LUBAC to dampen lymphocyte NF-kappa signalling. Nat Commun 2015 Nov 3 [PMID: 26525107] (WB, Human) WB Human
Lewis MJ, Vyse S, Shields AM et al. UBE2L3 Polymorphism Amplifies NF-kappa Activation and Promotes Plasma Cell Development, Linking Linear Ubiquitination to Multiple Autoimmune Diseases. Am J Hum Genet 2015 Feb 5 [PMID: 25640675] (WB, Human) WB Human
Kato K, Ishii R, Goto E et al. Structural and Functional Analyses of DNA-Sensing and Immune Activation by Human cGAS. PLoS One. 2013 Oct 7 [PMID: 24116191] (WB, Human) WB Human
Fiil BK, Damgaard RB, Wagner SA et al. OTULIN restricts Met1-linked ubiquitination to control innate immune signaling. Mol Cell. 2013 Jun 27 [PMID: 23806334] (WB, Human) WB Human

Review for RBCK1 Antibody (NBP1-88301) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-88301:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Anonymous
WB Mouse 04/28/2017
View

Summary

ApplicationWestern Blot
Sample TestedBone marrow-derived dendritic cells
SpeciesMouse

Comments

Comments5% NFDM in TBS-T was used for blocking, primary and secondary antibody incubations.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBCK1 Antibody (NBP1-88301) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBCK1 Products

Bioinformatics Tool for RBCK1 Antibody (NBP1-88301)

Discover related pathways, diseases and genes to RBCK1 Antibody (NBP1-88301). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBCK1 Antibody (NBP1-88301)

Discover more about diseases related to RBCK1 Antibody (NBP1-88301).
 

Pathways for RBCK1 Antibody (NBP1-88301)

View related products by pathway.

PTMs for RBCK1 Antibody (NBP1-88301)

Learn more about PTMs related to RBCK1 Antibody (NBP1-88301).
 

Research Areas for RBCK1 Antibody (NBP1-88301)

Find related products by research area.

Blogs on RBCK1

There are no specific blogs for RBCK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

 
Anonymous
04/28/2017
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol RBCK1