Home » RBCK1 » RBCK1 Antibodies » RBCK1 Antibody

RBCK1 Antibody

 (9 Publications)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: RBCK1 Antibody [NBP1-88301] - Analysis in human cell lines SK-MEL-30 and HeLa using anti-RBCK1 antibody. Corresponding RBCK1 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.
Orthogonal Strategies: Western Blot: RBCK1 Antibody [NBP1-88301] - Analysis in human cell lines SK-MEL-30 and HeLa using anti-RBCK1 antibody. Corresponding RBCK1 RNA-seq data are presented for the same cell ...read more
Western Blot: RBCK1 Antibody [NBP1-88301] - Analysis in human cell line HepG2.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

RBCK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEP
Specificity
Specificity of human RBCK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBCK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunoblotting
Application Notes
Use in immunoblotting reported in scientific literature (PMID: 28103322).
Control Peptide
Reviewed Applications
Read 1 Review rated 4
using
NBP1-88301 in the following applications:
Publications
Read Publications using
NBP1-88301 in the following applications:

  • IB
    1 publication
  • WB
    6 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25640675). Mouse reactivity reported in the scientific literature (PMID: 30209176). Expected reactivity in Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBCK1 Antibody

  • C20orf18
  • EC 6.3.2.-
  • HBV associated factor 4
  • HBV-associated factor 4
  • Heme-oxidized IRP2 ubiquitin ligase 1
  • Hepatitis B virus X-associated protein 4
  • HOIL-1
  • RanBP-type and C3HC4-type zinc finger containing 1
  • ranBP-type and C3HC4-type zinc finger-containing protein 1
  • RBCC protein interacting with PKC1
  • RBCK2
  • RNF54RING finger protein 54
  • UBCE7IP3HOIL1
  • ubiquitin conjugating enzyme 7 interacting protein 3
  • Ubiquitin-conjugating enzyme 7-interacting protein 3
  • XAP3
  • XAP4chromosome 20 open reading frame 18
  • ZRANB4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

HOIP/RNF31
Antibody (875227) [Un ...
MAB8039
Western blot shows lysates of Jurkat human acute T cell leukemia cell line and MCF‑7 human breast cancer cell line. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human HOIP/RNF31 Monoclonal Antibody (Catalog # MAB8039) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for HOIP/RNF31 at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
HOIP/RNF31 was detected in immersion fixed MCF‑7 human breast cancer cell line, untreated (upper panel) or treated with Proteasome Inhibitor I (Tocris Bioscience, Catalog # 4045, lower panel), using Mouse Anti-Human HOIP/RNF31 Monoclonal Antibody (Catalog # MAB8039) at 25 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for HOIP/RNF31 at approximately 144 kDa (as indicated) using 5 µg/mL of Mouse Anti-Human HOIP/RNF31 Monoclonal Antibody (Catalog # MAB8039). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(2 Publications)
Species: Hu
Applications: WB, Simple Western, ICC
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(26 Reviews)
(632 Publications)
Species: Hu
IKK gamma
Inhibitor Peptide Set
NBP2-26504
In vivo assay: IKK gamma Inhibitor Peptide Set [NBP2-26504] - NBD peptide blocks constitutive NF-kB as shown by EMSA. U266 cells were treated with 100 uM of control or NBD peptide for different time periods. Nuclear extracts were isolated and checked for NF-kB-DNA binding activity.
In vivo assay: IKK gamma Inhibitor Peptide Set [NBP2-26504] - NBD peptide blocks constitutive NF-kB activation in human multiple myeloma cells. U266 cells were treated with 100 uM of control (A & B) or NBD peptide (C & D) for 12 hr, cytospun, plated on glass slides, air dried for 1 hr at room temperature and fixed with cold acetone. Slides were blocked with 5% normal goat serum for 1 hr and then incubated with rabbit polyclonal anti-human p65 antibody (A & C) followed by Ig-Alexa 594 second step. In control peptide treated cells, p65 translocates to nucleus (A), whereas NBD peptide prevents translocation of p65 into the nucleus (C). B & D: Nuclear staining with DNA binding dye.
IKK gamma Inhibitor Peptide Set [NBP2-26504] - The IKK complex consists of IKKalpha + IKKbeta+ NEMO. NEMO (IKKgamma/NF-kB Essential MOdulator) is a scaffold protein required for the kinase activity of IKKalpha + IKKbeta. NBD (NEMO Binding Domain) inhibits formation of the IKK complex (IKKalpha + IKKbeta+ NEMO) by binding to NEMO and blocking IKK complex formation. In this regard, NBD is considered to be an 'IKKalpha and IKKBeta decoy' Blocking IKK complex formation suppresses downstream events in the NF-kB signaling pathway that rely on the IKK complex including phosphorylation of IkBalpha, and subsequence IkBalpha ubiquination, degradation and release of NF-kB. Hence, NF-kB is retained in the cytoplasm in its inactive state.
(23 Publications)
Species: Hu, Mu, Rt
SHARPIN Antibody
NBP2-27186
Immunohistochemistry-Paraffin: SHARPIN Antibody [NBP2-27186] - Formalin-fixed, paraffin-embedded human brain stained with Sharpin antibody (5 ug/ml), peroxidase-conjugate and DAB chromogen.
Species: Hu, Ca
Applications: WB, IHC, IHC-P
TRIM17 Antibody
(2E11)
H00051127-M01
Immunocytochemistry/Immunofluorescence: TRIM17 Antibody (2E11) [H00051127-M01] - Analysis of monoclonal antibody to TRIM17 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: TRIM17 Antibody (2E11) [H00051127-M01] - Detection limit for recombinant GST tagged TRIM17 is 0.03 ng/ml as a capture antibody.
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP1-31302
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with DLD antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: DLD protein stained by DLD antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Paraffin-embedded Gastric CA.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
IRP2 Antibody
NB100-1798
Western Blot: IRP2 Antibody [NB100-1798] - Raw macrophages (mouse) were either left untreated (lane 1) or treated overnight with 100mM DFO (lane 2) or 100mM hemin (lane 3). Proteins extracts were subjected to western blotting using IRP2 or b-actin antibodies diluted 1:500 in TBS-Tween.
Immunohistochemistry-Paraffin: IRP2 Antibody [NB100-1798] - IHC analysis of a formalin fixed paraffin-embedded (FFPE) human placenta using 1:300 conc. of IRP2 antibody on a Bond Rx autostainer (Leica Biosystems). The assay involved 30 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 9.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 15 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Cytoplasmic staining was observed in villi of endothelial cells.
Western Blot: IRP2 Antibody [NB100-1798] - Detection of IRP2 in mouse liver lysate.
(6 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, GS
ALDH9A1 Antibody
NBP1-89150
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: ALDH9A1 Antibody [NBP1-89150] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
ILT6/CD85e/LILRA3
Antibody [Unconjugate ...
AF2574
Human peripheral blood monoctyes were stained with Mouse Anti-Human CD14 APC‑conjugated Monoclonal Antibody (Catalog # FAB3832A) and either (A) Goat Anti-Human LILRA3/CD85e Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2574) or (B) Normal Goat IgG Control(Catalog # AB-108-C) followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.
Species: Hu
Applications: CyTOF-ready, ICFlow
TRAF-2 Antibody
(33A1293)
NB100-56715
Western Blot: TRAF-2 Antibody (33A1293) [NB100-56715] - Analysis of TRAF2 in HeLa lysate using TRAF2 antibody at 2 ug/ml.
Immunohistochemistry-Paraffin: TRAF-2 Antibody (33A1293) [NB100-56715] - Human transitional cell carcinoma of the urinary bladder stained with TRAF2 antibody at 5 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
(3 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
hnRNP C1 + C2
Antibody (SN0652)
NBP2-67656
Western Blot: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Analysis of hnRNP C1+C2 on different lysates using anti-hnRNP C1+C2 antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: MCF-7 Lane 3: HepG2
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Staining hnRNP C1+C2 in B16-F1 (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: hnRNP C1 + C2 Antibody (SN0652) [NBP2-67656] - Analysis of paraffin-embedded mouse skin tissue using anti-hnRNP C1+C2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
S5a/Angiocidin
Antibody
NBP2-37888
Western Blot: S5a/Angiocidin Antibody [NBP2-37888] - Analysis in control (vector only transfected HEK293T lysate) and PSMD4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: S5a/Angiocidin Antibody [NBP2-37888] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: S5a/Angiocidin Antibody [NBP2-37888] - Staining of human liver.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
RIPK1/RIP1 Antibody
NBP1-77077
Western Blot: RIPK1/RIP1 Antibody [NBP1-77077] - Rat kidney tissue lysate with RIPK1 antibody at 1 ug/mL.
Immunohistochemistry: RIPK1/RIP1 Antibody [NBP1-77077] - Staining of mouse kidney tissue with antibody at 2.5 ug/ml.
Immunohistochemistry-Paraffin: RIPK1/RIP1 Antibody [NBP1-77077] - Mouse kidney tissue with RIPK1 antibody at 2.5 ug/ml.
(1 Review)
(10 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF, KD
EYA1 Antibody
NBP2-87382
Western Blot: EYA1 Antibody [NBP2-87382] - Host: Rabbit. Target Name: EYA1. Sample Tissue: Human THP-1 Whole Cell. Antibody Dilution: 1ug/ml
Immunohistochemistry: EYA1 Antibody [NBP2-87382] - Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0ug/ml using anti-EYA1 antibody
Western Blot: EYA1 Antibody [NBP2-87382] - WB Suggested Anti-EYA1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human brain
Species: Hu
Applications: WB, IHC
TANK Antibody
NB100-56144
Immunohistochemistry: TANK Antibody - Unpurified [NB100-56144] - TANK Antibody [NB100-56144] - Immunohistochemical analysis of TANK/I-TRAF1 expression in formalin-fixed, paraffin-embedded normal human colon using this antibody at 1:2000. A-A3, low and high magnification images. Hematoxylin-eosin counterstain.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
ZNF645 Antibody
NBP2-21037
Western Blot: ZNF645 Antibody [NBP2-21037] - Sample (30 ug of whole cell lysate) A: MCF-7 10% SDS PAGE gel, diluted at 1:500.
Immunohistochemistry-Paraffin: ZNF645 Antibody [NBP2-21037] - Immunohistochemical analysis of paraffin-embedded GASTRIC CA, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RBCK1 Antibody (NBP1-88301)(9)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: IB, WB.


Filter By Application
IB
(1)
WB
(6)
All Applications
Filter By Species
Human
(6)
Mouse
(1)
All Species
Showing Publications 1 - 9 of 9.
Publications using NBP1-88301 Applications Species
Yamanaka S, Sato Y, Oikawa D et al. Subquinocin, a small molecule inhibitor of CYLD and USP-family deubiquitinating enzymes, promotes NF-kappa B signaling Biochem. Biophys. Res. Commun. Dec 30 2019 [PMID: 31898971]
MacDuff DA, Baldridge MT, Qaqish AM et al. HOIL1 is essential for the induction of type I and III interferons by MDA5 and regulates persistent murine norovirus infection. J. Virol. Sep 12 2018 [PMID: 30209176] (WB, Mouse) WB Mouse
Polajnar M, Dietz MS, Heilemann M, Behrends C. Expanding the host cell ubiquitylation machinery targeting cytosolic Salmonella EMBO Rep. 2017 Aug 06 [PMID: 28784601] (Human) Human
Shibata Y, Tokunaga F, Goto E et al. HTLV-1 Tax Induces Formation of the Active Macromolecular IKK Complex by Generating Lys63- and Met1-Linked Hybrid Polyubiquitin Chains PLoS Pathog Jan 1 2017 [PMID: 28103322] (IB, Human) IB Human
Nakazawa S, Oikawa D, Ishii R et al. Linear ubiquitination is involved in the pathogenesis of optineurin-associated amyotrophic lateral sclerosis. Nat Commun. Aug 24 2016 [PMID: 27552911] (WB) WB
Klein T, Fung SY, Renner F et al. The paracaspase MALT1 cleaves HOIL1 reducing linear ubiquitination by LUBAC to dampen lymphocyte NF-kappa signalling. Nat Commun 2015 Nov 3 [PMID: 26525107] (WB, Human) WB Human
Lewis MJ, Vyse S, Shields AM et al. UBE2L3 Polymorphism Amplifies NF-kappa Activation and Promotes Plasma Cell Development, Linking Linear Ubiquitination to Multiple Autoimmune Diseases. Am J Hum Genet 2015 Feb 5 [PMID: 25640675] (WB, Human) WB Human
Kato K, Ishii R, Goto E et al. Structural and Functional Analyses of DNA-Sensing and Immune Activation by Human cGAS. PLoS One. 2013 Oct 7 [PMID: 24116191] (WB, Human) WB Human
Fiil BK, Damgaard RB, Wagner SA et al. OTULIN restricts Met1-linked ubiquitination to control innate immune signaling. Mol Cell. 2013 Jun 27 [PMID: 23806334] (WB, Human) WB Human

Review for RBCK1 Antibody (NBP1-88301) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-88301:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Anonymous
 WB Mouse 04/28/2017
View

Summary

ApplicationWestern Blot
Sample TestedBone marrow-derived dendritic cells
SpeciesMouse

Comments

Comments5% NFDM in TBS-T was used for blocking, primary and secondary antibody incubations.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBCK1 Antibody (NBP1-88301) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional RBCK1 Products

Bioinformatics Tool for RBCK1 Antibody (NBP1-88301)

Discover related pathways, diseases and genes to RBCK1 Antibody (NBP1-88301). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBCK1 Antibody (NBP1-88301)

Discover more about diseases related to RBCK1 Antibody (NBP1-88301).
 

Pathways for RBCK1 Antibody (NBP1-88301)

View related products by pathway.

PTMs for RBCK1 Antibody (NBP1-88301)

Learn more about PTMs related to RBCK1 Antibody (NBP1-88301).
 

Research Areas for RBCK1 Antibody (NBP1-88301)

Find related products by research area.

Blogs on RBCK1

There are no specific blogs for RBCK1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0
 
 Anonymous
04/28/2017
Application: WB
Species: Mouse
read this review

Bioinformatics

Gene Symbol RBCK1
COVID-19 update