TRIM14 Antibody

Immunocytochemistry/Immunofluorescence: TRIM14 Antibody [NBP2-47596] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: TRIM14 Antibody [NBP2-47596] - Staining of human colon shows moderate cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: TRIM14 Antibody [NBP2-47596] - Staining of human tonsil shows moderate cytoplasmic positivity.

Immunohistochemistry-Paraffin: TRIM14 Antibody [NBP2-47596] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: TRIM14 Antibody [NBP2-47596] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.

Product Discontinued

TRIM14 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HIDNITQIEDATEKLKANAESSKTWLKGKFTELRLLLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDIMNDLS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM14
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TRIM14 Antibody

• KIAA0129tripartite motif-containing 14
• tripartite motif containing 14
• tripartite motif protein TRIM14
• tripartite motif-containing protein 14

Background

TRIM14 is encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been determined. Four alternatively spliced transcript variants for this gene have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRIM14