TRIM13 Antibody (1E5)

Images

 
Sandwich ELISA: TRIM13 Antibody (1E5) [H00010206-M02] - Detection limit for recombinant GST tagged TRIM13 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1E5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TRIM13 Antibody (1E5) Summary

Immunogen
TRIM13 (NP_005789, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKETSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQ
Specificity
This product is specific for Human TRIM13 monoclonal antibody (M02), clone 1E5 [Gene ID: 10206].
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRIM13
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
Mouse monoclonal antibody raised against a partial recombinant TRIM13.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRIM13 Antibody (1E5)

  • B-cell chronic lymphocytic leukemia tumor suppressor Leu5
  • CLL-associated RING finger
  • E3 ubiquitin-protein ligase TRIM13
  • EC 6.3.2.-
  • LEU5CAR
  • Leukemia-associated protein 5
  • Putative tumor suppressor RFP2
  • Ret finger protein 2RING finger protein 77
  • RFP2DLEU5
  • RNF77Leu5
  • tripartite motif containing 13
  • tripartite motif protein 13
  • tripartite motif-containing 13
  • Tripartite motif-containing protein 13

Background

Ret finger protein 2 This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This gene is located on chromosome 6. Multiple alternatively spliced transcript variants have been found for this gene. Mouse polyclonal antibody raised against a partial recombinant RFP2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TRIM13 Antibody (H00010206-M02) (0)

There are no publications for TRIM13 Antibody (H00010206-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM13 Antibody (H00010206-M02) (0)

There are no reviews for TRIM13 Antibody (H00010206-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRIM13 Antibody (H00010206-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIM13 Products

Research Areas for TRIM13 Antibody (H00010206-M02)

Find related products by research area.

Blogs on TRIM13

There are no specific blogs for TRIM13, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM13 Antibody (1E5) and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM13
Uniprot