TRIB3 Antibody (2D1) - Azide and BSA Free

Western Blot: TRIB3 Antibody (2D1) [H00057761-M08] - TRIB3 monoclonal antibody (M08), clone 2D1 Western Blot analysis of TRIB3 expression in HepG2 ( Cat # L019V1 ).

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2D1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TRIB3 Antibody (2D1) - Azide and BSA Free Summary

• Immunogen: TRIB3 (AAH27484, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDMH
• Specificity: TRIB3 - tribbles homolog 3 (Drosophila)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TRIB3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRIB3 Antibody (2D1) - Azide and BSA Free

• C20orf97
• dJ1103G7.3
• neuronal cell death inducible putative kinase
• Neuronal cell death-inducible putative kinase
• NIPK
• p65-interacting inhibitor of NF-kappaB
• p65-interacting inhibitor of NF-kappa-B
• SINK
• SKIP3
• TRB-3
• TRB3chromosome 20 open reading frame 97
• tribbles homolog 3 (Drosophila)
• tribbles homolog 3

Background

The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRIB3
• Entrez:
  • 57761(Human)
• OMIM:
  • 607898(Human)
• Uniprot:
  • AAH27484(Human)