TRIB3 Antibody (1H2) - Azide and BSA Free

Western Blot: TRIB3 Antibody (1H2) [H00057761-M03] - Analysis of TRIB3 expression in transfected 293T cell line by TRIB3 monoclonal antibody (M03), clone 1H2. Lane 1: TRIB3 transfected lysatE (39.6 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: TRIB3 Antibody (1H2) [H00057761-M03] - Analysis of monoclonal antibody to TRIB3 on A-431 cell. Antibody concentration 10 ug/ml

Western Blot: TRIB3 Antibody (1H2) [H00057761-M03] - TRIB3 expression in A-431 ( Cat # L015V1 ).

Western Blot: TRIB3 Antibody (1H2) [H00057761-M03] - TRIB3 over-expressed 293 cell line, cotransfected with TRIB3 Validated Chimera RNAi or non-transfected control. Blot probed with H00057761-M03. GAPDH (36.1 kDa) used as loading control.

Western Blot: TRIB3 Antibody (1H2) [H00057761-M03] - Representative images and colony numbers of LCs from the indicated groups with or withoutTRIB3(H00057761-M03) deletion Data are presented as the means+/- S.E.M from three independent experiments. Statistical significance was determined by two-tailed Studentst test.P value: 0.0005, 0.0032. 0.0097, and 0.0074. Scale bar, 50um. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33298911/) licensed under a CC-BY license.

Western Blot: TRIB3 Antibody (1H2) [H00057761-M03] - Disturbing the TRIB3/MYC interaction attenuates lymphoma in mice.a The strategy for investigating the anti-BCL effects of PCM4 on MycEμ mice in vivo. b, c The data represent the statistical analyses of spleen & LN weights in MycEμ mice (5 months old; n = 7 per group) treated with the indicated agents. Data are represented as means ± SEM. Statistical significance was determined by two-tailed Student’s t test. P value: 0.016; 0.0108, & 0.0038 (b); 0.003, 0.0003, 7.34 × 10−5 (c). d Representative images of Ki67 staining (left) & statistical analyses of Ki67-positive cells (right) in the spleens of MycEμ mice (5 months old; n = 12 per group) treated with the indicated agents. Scale bar, 50 μm. Data are represented as means ± SEM. Statistical significance was determined by two-tailed Student’s t test. P value: 1.28 × 10−9, 7.86 × 10−10, & 1.13 × 10−9. e The tumorigenicity of BCL cells from the indicated mice was compared by limiting dilution transplantation into NSG mice; n = 8 mice per group. f PCM4 disturbed the TRIB3/MYC interaction in vivo. Spleen lysates from the indicated mice (5 months old) were IP with an anti-TRIB3 Ab & blotted with an anti-MYC Ab. The data are representative of three independent assays. g PCM4-reduced MYC expression. LN & spleen extracts from the indicated mice (5 months old) were blotted with an anti-MYC Ab. The data are presented as representative from three independent experiments. h Kaplan–Meier survival curves for MycEμ BCL mice treated with the indicated agents (n = 10 per group). Statistical difference was determined by two-sided log-rank test. P value: 0.0214 (DOX + PCM4 vs. DOX + PCON). Source data are provided as a Source Data file. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/33298911), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, Func, ICC/IF, KO, Mycoplasma
• Clone: 1H2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TRIB3 Antibody (1H2) - Azide and BSA Free Summary

• Description: Novus Biologicals Knockout (KO) Validated Mouse TRIB3 Antibody (1H2) - Azide and BSA Free (H00057761-M03) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. Anti-TRIB3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: TRIB3 (AAH27484, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDMH
• Specificity: TRIB3 - tribbles homolog 3 (Drosophila)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TRIB3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Knockdown Validated
  • Knockout Validated
  • Proximity Ligation Assay
  • Western Blot
• Application Notes: Use in PLA reported in scientific literature (PMID:33298911).

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:33298911) Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRIB3 Antibody (1H2) - Azide and BSA Free

• C20orf97
• dJ1103G7.3
• neuronal cell death inducible putative kinase
• Neuronal cell death-inducible putative kinase
• NIPK
• p65-interacting inhibitor of NF-kappaB
• p65-interacting inhibitor of NF-kappa-B
• SINK
• SKIP3
• TRB-3
• TRB3chromosome 20 open reading frame 97
• tribbles homolog 3 (Drosophila)
• tribbles homolog 3

Background

The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TRIB3 Antibody (H00057761-M03)(1)

Publication using H00057761-M03

• Li K, Wang F, Yang ZN et al. TRIB3 promotes MYC-associated lymphoma development through suppression of UBE3B-mediated MYC degradation Nature communications 2020-12-09 [PMID: 33298911] (PLA, WB, Mouse)

Bioinformatics

• Gene Symbol: TRIB3
• Entrez:
  • 57761(Human)
• OMIM:
  • 607898(Human)
• Uniprot:
  • AAH27484(Human)