Recombinant Human TRERF1 GST (N-Term) Protein

SDS-Page: Recombinant Human TRERF1 Protein [H00055809-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human TRERF1 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence of (NP_060885.1) for Human TRERF1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: AQVLHTQSAVMDGAPDSALRQLLSQKPMEPPAPAIPSRYQQVPQQPHPGFTGGLSKPALQVGQHPTQGHLYYDYQQPLAQVPVQGGQPL

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: TRERF1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 35.53 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRERF1 GST (N-Term) Protein

• BCAR2
• Breast cancer estrogen resistance 2RAPAHSA277276
• dJ139D8.5
• FLJ21198
• rapa-1
• rapa-2
• RP1-139D8.5
• transcriptional regulating factor 1
• transcriptional regulating protein 132
• transcriptional-regulating factor 1
• Transcriptional-regulating protein 132
• TREP132
• TReP-132
• Zinc finger protein rapa
• Zinc finger transcription factor TReP-132

Background

The transcriptional regulating protein of 132 kDa (TReP-132/TRERF1) was identified as a transcription factor that interacts with and activates the promoter of the CYP11A1 gene, a gene that encodes cytochrome P450 side chain cleavage (P450scc) and catalyzes the first step in steroidgenesis. TRep-132 can function as a nuclear receptor co-activator and has been shown to interact with Sp1 and the progesterone receptor (PR) to suppress growth via activation of the gene promoters of the cyclin-dependent kinase inhibitors, p21 and p27.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TRERF1