TRAR4 Antibody - BSA Free

Western Blot: TRAR4 Antibody [NBP2-86871] - WB Suggested Anti-TAAR6 Antibody. Titration: 1.0 ug/ml. Positive Control: A549 Whole Cell

Immunohistochemistry: TRAR4 Antibody [NBP2-86871] - Researcher: Timur Mavlyutov, University of Wisconsin Medical School. Application: IHC. Species+tissue/cell type: Ventral horn region of mouse spinal cord. Primary antibody dilution: 1:200. Secondary antibody: Donkey anti-rabbit CY2. Secondary antibody dilution:1:500

Immunohistochemistry: TRAR4 Antibody [NBP2-86871] - Researcher:Timur Mavlyutov, Ph. D., University of Wisconsin Medical School. Application: IHC. Species+tissue/cell type:Rhesus macaque spinal cord. Primary antibody dilution: 1:300. Secondary antibody: Donkey anti Rabbit 488. Secondary antibody dilution: 1:500

• Reactivity: Hu, Mu, Pm
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TRAR4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TRAR4 Antibody - BSA Free (NBP2-86871) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRAR4. Peptide sequence: YGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAAR6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TRAR4 Antibody - BSA Free

• RP11-295F4.3
• TA4taR-6
• TAR4
• TaR-4
• TAR6
• TaR-6
• trace amine associated receptor 6
• Trace amine receptor 4taR-4
• Trace amine receptor 6
• TRAR4trace amine-associated receptor 6

Background

FUNCTION: Orphan receptor. Could be a receptor for trace amines. Trace amines are biogenic amines present in very low levels in mammalian tissues. Although some trace amines have clearly defined roles as neurotransmitters in invertebrates, the extent to which they function as true neurotransmitters in vertebrates has remained speculative. Trace amines are likely to be involved in a variety of physiological functions that have yet to be fully understood. SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Expressed at low abundance in various brain tissues, as well as in fetal liver, but not in the cerebellum or placenta. In the brain, comparable levels of expression in basal ganglia, frontal cortex, substantia nigra, amygdala and hippocampus, highest expression in hippocampus and lowest expression in basal ganglia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAAR6