Home » TRAR4 » TRAR4 Antibodies » TRAR4 Antibody

TRAR4 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: TRAR4 Antibody [NBP2-86871] - WB Suggested Anti-TAAR6 Antibody. Titration: 1.0 ug/ml. Positive Control: A549 Whole Cell
Western Blot: TRAR4 Antibody [NBP2-86871] - WB Suggested Anti-TAAR6 Antibody. Titration: 1.0 ug/ml. Positive Control: A549 Whole Cell
Immunohistochemistry: TRAR4 Antibody [NBP2-86871] - Researcher: Timur Mavlyutov, University of Wisconsin Medical School. Application: IHC. Species+tissue/cell type: Ventral horn region of mouse spinal cord. Primary ...read more
Immunohistochemistry: TRAR4 Antibody [NBP2-86871] - Researcher:Timur Mavlyutov, Ph. D., University of Wisconsin Medical School. Application: IHC. Species+tissue/cell type:Rhesus macaque spinal cord. Primary antibody ...read more

Product Details

Summary
Reactivity Hu, Mu, PmSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TRAR4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRAR4. Peptide sequence: YGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
TAAR6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRAR4 Antibody

  • RP11-295F4.3
  • TA4taR-6
  • TAR4
  • TaR-4
  • TAR6
  • TaR-6
  • trace amine associated receptor 6
  • Trace amine receptor 4taR-4
  • Trace amine receptor 6
  • TRAR4trace amine-associated receptor 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Trace Amine
Receptor 1 Antibody
NBP2-24714
Western Blot: Trace Amine Receptor 1 Antibody [NBP2-24714] - Analysis of human TAAR1 in human brain lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse brain lysate and 4) rat brain lysate using NBP2-24714 at 2 ug/ml.
Immunohistochemistry-Paraffin: Trace Amine Receptor 1 Antibody [NBP2-24714] - Analysis of TAAR1 in paraffin-embedded formalin-fixed mouse brain tissue using a rabbit isotype control (top) and (bottom) at 5 ug/ml.
(1 Publication)
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
TAAR9 Antibody
NBP2-86841
Western Blot: TAAR9 Antibody [NBP2-86841] - Host: Rabbit. Target Name: TAAR9. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml
Species: Hu
Applications: WB
Adenine Nucleotide
Translocator 2 Antibo ...
NBP2-92630
Immunocytochemistry/Immunofluorescence: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Analysis of HeLa cells using Adenine Nucleotide Translocator 2 . Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Paraffin-embedded mouse heart using Adenine Nucleotide Translocator 2 .
Western Blot: Adenine Nucleotide Translocator 2 Antibody [NBP2-92630] - Analysis of extracts of various cell lines, using Adenine Nucleotide Translocator 2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 60s.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Dysbindin Antibody
NBP1-85299
Immunocytochemistry/Immunofluorescence: Dysbindin Antibody [NBP1-85299] - Staining of human cell line A-431 shows localization to microtubules. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299] - Staining of human lymph node shows very strong cytoplasmic positivity in germinal center cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
COMT Antibody
NB100-1780
Western Blot: COMT Antibody [NB100-1780] - Staining of Human Liver (A) with antibody at 2 ug/mL and Ovary (B) lysate (35 ug protein in RIPA buffer) with antibody at 1 ug/mL. Detected by chemiluminescence.
Western Blot: COMT Antibody [NB100-1780] - Staining of MCF7 (A) with antibody at 0.5 ug/mL, U251 cell lysate 1 (B) and U251 cell lysate 2 (C) (35 ug protein in RIPA buffer) with antibody at 1 ug/mL. Detected by chemiluminescence.
Flow Cytometry: COMT Antibody [NB100-1780] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(3 Publications)
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
FMN1 Antibody (4F4)
H00342184-M07
ELISA: FMN1 Antibody (4F4) [H00342184-M07] - Detection limit for recombinant GST tagged FMN1 is 3 ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: FMN1 Antibody (4F4) [H00342184-M07] - Analysis of monoclonal antibody to FMN1 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: FMN1 Antibody (4F4) [H00342184-M07] - Analysis of FMN1 expression in human colon.
Species: Hu
Applications: ELISA, ICC/IF, WB
beta Sarcoglycan
Antibody
NBP1-90300
Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human heart muscle shows strong membranous and cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human prostate shows very weak membranous positivity in smooth muscle cells.
(4 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
CIITA Antibody -
BSA Free
NBP2-59072
Immunohistochemistry-Paraffin: CIITA Antibody [NBP2-59072] - Human brain tissue. Antibody concentration of 10 ug/ml.
Western Blot: CIITA Antibody [NBP2-59072] - Analysis of CIITA in rat brain tissue lysate with CIITA antibody at 1 ug/mL.
Immunocytochemistry/Immunofluorescence: CIITA Antibody [NBP2-59072] - Human brain tissue with CIITA antibody.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows 25 ng of Recombinant Human EphB2 Fc Chimera (Catalog # 5189-B2) and Recombinant Mouse EphB2 Fc Chimera (Catalog # 467-B2). PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for EphB2 at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
EphB2 was detected in immersion fixed MBA‑MB‑468 human breast cancer cell line using Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(9 Reviews)
(37 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(26 Reviews)
(338 Publications)
Species: Hu
Applications: BA
ERK2 Antibody
(SZ25-01)
NBP2-67360
Flow Cytometry: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of Hela cells with ERK2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
RGS4 Antibody
NBP2-94071
Immunocytochemistry/Immunofluorescence: RGS4 Antibody [NBP2-94071] - Analysis of L929 cells using RGS4 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: RGS4 Antibody [NBP2-94071] - Analysis of U-2 OS cells using RGS4 at dilution of 1:100. Blue: DAPI for nuclear staining.
Western Blot: RGS4 Antibody [NBP2-94071] - Analysis of extracts of various cell lines, using RGS4 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 1s.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(27 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Cytokeratin 19
Antibody - BSA Free
NB100-687
Flow Cytometry: Cytokeratin 19 Antibody [NB100-687] - An intracellular stain was performed on MCF7 cells with Cytokeratin 19 Antibody NB100-687AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Western Blot: Cytokeratin 19 Antibody [NB100-687] - Western blot detection of YAP and TAZ in proteins extracted from isolated hepatocytes and cholangiocytes and total liver tissue. Antibodies against CK19 and HNF4a were used to confirm purity of the populations and b-actin was used as a loading control. Representative results from a single experiment with n = 3 independent cell isolations and n = 2 total liver tissues. Image collected and cropped by CiteAb from the following publication(http://embomolmed.embopress.org/lookup/doi/10.15252/emmm.201506089), licensed under a CC-BY licence.
Immunohistochemistry: Cytokeratin 19 Antibody [NB100-687] - Inhibition of MST improves liver regeneration in aged mice. Representative photomicrograph of an aged liver treated with siMST and stained with H&E and by IHC for CK19 and Ki67. Arrows indicate ductal regions with no signs of reaction or oval cell expansion. Image collected and cropped by CiteAb from the following publication (http://embomolmed.embopress.org/lookup/doi/10.15252/emmm.201506089), licensed under a CC-BY licence.
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
TAAR3 Antibody
NBP3-10153
Western Blot: TAAR3 Antibody [NBP3-10153] - Western blot analysis of TAAR3 in Rat Stomach lysates. Antibody dilution at 1ug/ml
Species: Rt
Applications: WB
APC Antibody - BSA
Free
NB100-91662
Immunocytochemistry/Immunofluorescence: APC Antibody [NB100-91662] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-APC Antibody at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: APC Antibody [NB100-91662] - An intracellular stain was performed on HeLa cells with APC Antibody NB100-91662AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Immunohistochemistry-Paraffin: APC Antibody [NB100-91662] - Paraffin-embedded human colon carcinoma tissue.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Neuregulin-1 beta
1/NRG1 beta 1
396-HB/CF
1 μg/lane of Recombinant Human NRG1-beta 1/HRG1-beta 1 EGF Domain was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 8 kDa.
Recombinant Human NRG1-beta 1/HRG1-beta 1 EGF Domain (Catalog # 396-HB/CF) stimulates cell proliferation of the MCF-7 human breast cancer cell line. The ED50 for this effect is 0.06-0.3 ng/mL.
(62 Publications)
Species: Hu
Applications: BA
TEF1 Antibody
NBP2-94035
Chromatin Immunoprecipitation: TEF1 Antibody [NBP2-94035] - Analysis of extracts of HeLa cell line, using TEF1 rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Immunocytochemistry/Immunofluorescence: TEF1 Antibody [NBP2-94035] - Analysis of MCF7 cells using TEF1 .
Western Blot: TEF1 Antibody [NBP2-94035] - Analysis of extracts of various cell lines, using TEAD1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 180s.
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
FoxC2 Antibody
AF6989
FoxC2 was detected in immersion fixed frozen sections of mouse embryo (E15.5) using Sheep Anti-Mouse FoxC2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6989) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to periocular mesenchyme. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(8 Publications)
Species: Mu
Applications: IHC
KOR Antibody
(387310) [Unconjugate
MAB38951
KOR was detected in immersion fixed paraffin-embedded sections of human brainstem (medulla) using 15 µg/mL Mouse Anti-Human KOR Monoclonal Antibody (Catalog # MAB38951) overnight at 4 °C. Before incubation with the primary antibody tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: IHC

Publications for TRAR4 Antibody (NBP2-86871) (0)

There are no publications for TRAR4 Antibody (NBP2-86871).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAR4 Antibody (NBP2-86871) (0)

There are no reviews for TRAR4 Antibody (NBP2-86871). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRAR4 Antibody (NBP2-86871) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRAR4 Products

Array NBP2-86871

Bioinformatics Tool for TRAR4 Antibody (NBP2-86871)

Discover related pathways, diseases and genes to TRAR4 Antibody (NBP2-86871). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAR4 Antibody (NBP2-86871)

Discover more about diseases related to TRAR4 Antibody (NBP2-86871).
 

Pathways for TRAR4 Antibody (NBP2-86871)

View related products by pathway.

PTMs for TRAR4 Antibody (NBP2-86871)

Learn more about PTMs related to TRAR4 Antibody (NBP2-86871).
 

Research Areas for TRAR4 Antibody (NBP2-86871)

Find related products by research area.

Blogs on TRAR4

There are no specific blogs for TRAR4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAR4 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TAAR6