TRAR4 Antibody

Images

 
Western Blot: TRAR4 Antibody [NBP2-86871] - WB Suggested Anti-TAAR6 Antibody. Titration: 1.0 ug/ml. Positive Control: A549 Whole Cell
Immunohistochemistry: TRAR4 Antibody [NBP2-86871] - Researcher: Timur Mavlyutov, University of Wisconsin Medical School. Application: IHC. Species+tissue/cell type: Ventral horn region of mouse spinal cord. Primary ...read more
Immunohistochemistry: TRAR4 Antibody [NBP2-86871] - Researcher:Timur Mavlyutov, Ph. D., University of Wisconsin Medical School. Application: IHC. Species+tissue/cell type:Rhesus macaque spinal cord. Primary antibody ...read more

Product Details

Summary
Reactivity Hu, Mu, PmSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRAR4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRAR4. Peptide sequence: YGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
TAAR6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRAR4 Antibody

  • RP11-295F4.3
  • TA4taR-6
  • TAR4
  • TaR-4
  • TAR6
  • TaR-6
  • trace amine associated receptor 6
  • Trace amine receptor 4taR-4
  • Trace amine receptor 6
  • TRAR4trace amine-associated receptor 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24714
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-86841
Species: Hu
Applications: WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85299
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1780
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-90300
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-59072
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
202-IL
Species: Hu
Applications: BA
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-94071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB100-687
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP3-10153
Species: Rt
Applications: WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
396-HB/CF
Species: Hu
Applications: BA
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
AF6989
Species: Mu
Applications: IHC
MAB38951
Species: Hu
Applications: IHC

Publications for TRAR4 Antibody (NBP2-86871) (0)

There are no publications for TRAR4 Antibody (NBP2-86871).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAR4 Antibody (NBP2-86871) (0)

There are no reviews for TRAR4 Antibody (NBP2-86871). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRAR4 Antibody (NBP2-86871) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRAR4 Products

Array NBP2-86871

Bioinformatics Tool for TRAR4 Antibody (NBP2-86871)

Discover related pathways, diseases and genes to TRAR4 Antibody (NBP2-86871). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAR4 Antibody (NBP2-86871)

Discover more about diseases related to TRAR4 Antibody (NBP2-86871).
 

Pathways for TRAR4 Antibody (NBP2-86871)

View related products by pathway.

PTMs for TRAR4 Antibody (NBP2-86871)

Learn more about PTMs related to TRAR4 Antibody (NBP2-86871).
 

Research Areas for TRAR4 Antibody (NBP2-86871)

Find related products by research area.

Blogs on TRAR4

There are no specific blogs for TRAR4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAR4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAAR6