Trappin-2/Elafin/Skalp Antibody

Images

 
Western Blot: Trappin-2/Elafin/Skalp Antibody [NBP1-85690] - Analysis in control (vector only transfected HEK293T lysate) and pI3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: Trappin-2/Elafin/Skalp Antibody [NBP1-85690] - Staining of human oral mucosa shows moderate cytoplasmic positivity in superficial cells of squamous epithelia.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Trappin-2/Elafin/Skalp Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PI3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Trappin-2/Elafin/Skalp Protein (NBP1-85690PEP)
Publications
Read Publications using
NBP1-85690 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23631827)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Trappin-2/Elafin/Skalp Antibody

  • cementoin
  • Elafin
  • Elastase-specific inhibitor
  • ESI
  • ESIWAP four-disulfide core domain protein 14
  • Peptidase inhibitor 3
  • peptidase inhibitor 3, skin-derived
  • PI3
  • PI-3
  • pre-elafin
  • protease inhibitor 3, skin-derived (SKALP)
  • Protease inhibitor WAP3
  • SKALP
  • SKALPELAFIN
  • Skin-derived antileukoproteinase
  • Trappin2
  • Trappin-2
  • WAP four-disulfide core domain 14
  • WAP3MGC13613
  • WFDC14elafin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-85690
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Trappin-2/Elafin/Skalp Antibody (NBP1-85690)(3)

Reviews for Trappin-2/Elafin/Skalp Antibody (NBP1-85690) (0)

There are no reviews for Trappin-2/Elafin/Skalp Antibody (NBP1-85690). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Trappin-2/Elafin/Skalp Antibody (NBP1-85690) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Trappin-2/Elafin/Skalp Products

Bioinformatics Tool for Trappin-2/Elafin/Skalp Antibody (NBP1-85690)

Discover related pathways, diseases and genes to Trappin-2/Elafin/Skalp Antibody (NBP1-85690). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Trappin-2/Elafin/Skalp Antibody (NBP1-85690)

Discover more about diseases related to Trappin-2/Elafin/Skalp Antibody (NBP1-85690).
 

Pathways for Trappin-2/Elafin/Skalp Antibody (NBP1-85690)

View related products by pathway.

PTMs for Trappin-2/Elafin/Skalp Antibody (NBP1-85690)

Learn more about PTMs related to Trappin-2/Elafin/Skalp Antibody (NBP1-85690).

Blogs on Trappin-2/Elafin/Skalp

There are no specific blogs for Trappin-2/Elafin/Skalp, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Trappin-2/Elafin/Skalp Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PI3
Entrez