TRAP220/MED1 Recombinant Protein Antigen

Images

 
There are currently no images for TRAP220/MED1 Recombinant Protein Antigen (NBP2-57045PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TRAP220/MED1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRAP220/MED1.

Source: E. coli

Amino Acid Sequence: MEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MED1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57045.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRAP220/MED1 Recombinant Protein Antigen

  • Activator-recruited cofactor 205 kDa component
  • ARC205
  • CRSP1TRIP2
  • CRSP200p53 regulatory protein RB18A
  • DRIP230
  • DRIP230PPAR-binding protein
  • MBD4
  • MED1
  • mediator complex subunit 1DRIP205
  • mediator of RNA polymerase II transcription subunit 1
  • PBPPPARGBP
  • Peroxisome proliferator-activated receptor-binding protein
  • PPAR binding protein
  • PPARBP
  • PPARBPMGC71488
  • PPARG binding protein
  • PPARGBP
  • RB18ATR-interacting protein 2
  • Thyroid hormone receptor-associated protein complex 220 kDa component
  • thyroid hormone receptor-associated protein complex component TRAP220
  • thyroid receptor interacting protein 2
  • Thyroid receptor-interacting protein 2
  • TRAP220
  • TRAP220TRIP-2
  • TRIP2
  • vitamin D receptor-interacting protein 230 kD
  • Vitamin D receptor-interacting protein complex component DRIP205

Background

MED1, also referred to as Mediator Complex Subunit 1, localizes to the nucleus and is involved in DNA repair. MED1 is able to remove Uracil in Uracil-Guanine mismatched base-pairs. Current research on MED1 is being performed in relation to several diseases and disorders including ovarian cancer, thyroiditis, breast cancer, Parkinson's disease, influenza, alopecia, Williams syndrome, diabetes mellitus, ataxia telangiectasia, thyroid cancer, Alzheimer's disease and rickets. MED1 has also been shown to have interactions with p53, MED15, RARA, KAT2A, and CDK8 in pathways such as fatty acid, triacylglycerol, and ketone body metabolism and the PPAR pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NB200-310
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
H00000054-D01P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
DCDL40
Species: Hu
Applications: ELISA
NB100-56173
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
DY393
Species: Hu
Applications: ELISA
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-66778
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NB200-335
Species: Hu
Applications: IHC, IHC-P, IP, WB
H00001594-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, WB
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB

Publications for TRAP220/MED1 Recombinant Protein Antigen (NBP2-57045PEP) (0)

There are no publications for TRAP220/MED1 Recombinant Protein Antigen (NBP2-57045PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAP220/MED1 Recombinant Protein Antigen (NBP2-57045PEP) (0)

There are no reviews for TRAP220/MED1 Recombinant Protein Antigen (NBP2-57045PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TRAP220/MED1 Recombinant Protein Antigen (NBP2-57045PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRAP220/MED1 Products

Research Areas for TRAP220/MED1 Recombinant Protein Antigen (NBP2-57045PEP)

Find related products by research area.

Blogs on TRAP220/MED1

There are no specific blogs for TRAP220/MED1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRAP220/MED1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MED1