TRAP alpha Antibody

Images

 
Western Blot: TRAP alpha Antibody [NBP1-87815] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-87815] - Staining of human pancreas shows strong positivity in exocrine cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRAP alpha Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VSGEPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SSR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRAP alpha Protein (NBP1-87815PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRAP alpha Antibody

  • DKFZp781N23103
  • FLJ14232
  • FLJ22100
  • FLJ23034
  • FLJ78242
  • FLJ93042
  • signal sequence receptor, alpha
  • SSR alpha subunit
  • SSR-alpha
  • translocon-associated protein alpha subunit
  • translocon-associated protein subunit alpha
  • TRAP alpha
  • TRAP-alpha
  • TRAPASignal sequence receptor subunit alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69471
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56420
Species: Hu
Applications: WB, ICC/IF
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-22553
Species: Hu
Applications: WB, ELISA
NBP2-16890
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TRAP alpha Antibody (NBP1-87815) (0)

There are no publications for TRAP alpha Antibody (NBP1-87815).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAP alpha Antibody (NBP1-87815) (0)

There are no reviews for TRAP alpha Antibody (NBP1-87815). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRAP alpha Antibody (NBP1-87815) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRAP alpha Products

Bioinformatics Tool for TRAP alpha Antibody (NBP1-87815)

Discover related pathways, diseases and genes to TRAP alpha Antibody (NBP1-87815). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAP alpha Antibody (NBP1-87815)

Discover more about diseases related to TRAP alpha Antibody (NBP1-87815).
 

Pathways for TRAP alpha Antibody (NBP1-87815)

View related products by pathway.

Research Areas for TRAP alpha Antibody (NBP1-87815)

Find related products by research area.

Blogs on TRAP alpha

There are no specific blogs for TRAP alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAP alpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SSR1