TRAP alpha Antibody - BSA Free

Western Blot: TRAP alpha Antibody [NBP1-87815] - Analysis using Anti-SSR1 antibody NBP1-87815 (A) shows similar pattern to independent antibody NBP1-86912 (B).

Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-87815] - Staining of human lymph node.

Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-87815] - Staining of human cerebral cortex, liver, lymph node and pancreas using Anti-SSR1 antibody NBP1-87815 (A) shows similar protein distribution across tissues to independent antibody NBP1-86912 (B).

Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-87815] - Staining of human pancreas.

Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-87815] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-87815] - Staining of human liver.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRAP alpha Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TRAP alpha Antibody - BSA Free (NBP1-87815) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VSGEPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVT
• Predicted Species: Mouse (99%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SSR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TRAP alpha Protein (NBP1-87815PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TRAP alpha Antibody - BSA Free

• DKFZp781N23103
• FLJ14232
• FLJ22100
• FLJ23034
• FLJ78242
• FLJ93042
• signal sequence receptor, alpha
• SSR alpha subunit
• SSR-alpha
• translocon-associated protein alpha subunit
• translocon-associated protein subunit alpha
• TRAP alpha
• TRAP-alpha
• TRAPASignal sequence receptor subunit alpha

Background

The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein encoded by this gene and a 22-kD glycoprotein. This gene generates several mRNA species as a result of complex alternative polyadenylation. This gene is unusual in that it utilizes arrays of polyA signal sequences that are mostly non-canonical.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SSR1