Recombinant Human Transthyretin/Prealbumin Y78F Variant, Monomer Protein Summary
| Description |
A full length recombinant protein of Human Transthyretin/Prealbumin corresponding to the following sequence with Y78F variant: MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKT
SESGELHGLTTEEEFVEGIYKVEIDTKSFWKALGISPFHEHAEVVFTAND
SGPRRYTIAALLSPYSYSTTAVVTNPKE Source: E. coli Uniprot ID: P02766 |
| Localization |
Cytoplasm, Extracellular exosome, Extracellular Region, Lysosome |
Preparation Method |
Ion-exchange Purified |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
TTR |
| Purity |
>95%, by SDS-PAGE |
Applications/Dilutions
| Dilutions |
- In vitro assay
- In vivo assay
- SDS-Page
- Western Blot
|
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS pH 7.4 |
| Preservative |
No Preservative |
| Purity |
>95%, by SDS-PAGE |
Notes
Please note that the 200ug and 500ug sizes are sent in 2x100ug and 5x100ug vials, respectively
Alternate Names for Recombinant Human Transthyretin/Prealbumin Y78F Variant, Monomer Protein
Background
Prealbumin is a serum protein usually occurring at 200-400mg/L serum. Prealbumin migrates faster than albumin in acidic starch gels and include alpha 1 antitrypsin, thyroxine binding prealbumin, and orosomucoid, an alpha 1 acid glycoprotein. The functions of prealbumin are to transport thyroxine, a task it shares with thyroxine binding globulin, retinol binding protein and vitamin A. Polymorphism of prealbumin is known in the mouse and pig.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Dual ISH-IHC, IHC, IP, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: WB, Func, PAGE
Publications for Transthyretin/Prealbumin Recombinant Protein (NBP3-14787) (0)
There are no publications for Transthyretin/Prealbumin Recombinant Protein (NBP3-14787).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Transthyretin/Prealbumin Recombinant Protein (NBP3-14787) (0)
There are no reviews for Transthyretin/Prealbumin Recombinant Protein (NBP3-14787).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Transthyretin/Prealbumin Recombinant Protein (NBP3-14787) (0)
Additional Transthyretin/Prealbumin Products
Research Areas for Transthyretin/Prealbumin Recombinant Protein (NBP3-14787)
Find related products by research area.
|
Blogs on Transthyretin/Prealbumin