Translin Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Translin Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TSN.
  
  

  Source: E. coli

  Amino Acid Sequence: MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAGF

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: TSN
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31779.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Translin Recombinant Protein Antigen

• BCLF-1
• RCHF1
• recombination hotspot associated factor
• recombination hotspot-binding protein
• REHF-1
• TBRBP
• translin
• TRSLN

Background

Translin, also designated testis brain RNA-binding protein (TB-RBP), is a single-stranded DNA- and RNA-binding protein that binds to the 3' UTR regions (Y and H elements) of stored mRNAs, which suppresses their in vitro translation. The human translin gene maps to chromosome 2q21.1 and encodes a 26 kDa protein that has been highly conserved throughout evolution. Translin forms a ring-shaped structure, which is responsible for DNA binding, and also contains a leucine zipper motif, which is thought to enable translin to form dimers. Translin exports specific mRNAs out of the nucleus, supported by its localization in both the nuclei and cytoplasm of neurons, and regulates their translation. Association with Trax (translin-associated factor X), inhibits the binding of translin to RNA, but enhances its binding to single stranded DNA sequences. Breakpoints in the TLS/FUS and CHOP loci contain consensus recognition motifs of translin, which associates with chromosomal translocations in liposarcomas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TSN