Translin Antibody - BSA Free

Western Blot: Translin Antibody [NBP2-85979] - Host: Rabbit. Target Name: TSN. Sample Tissue: Human HT1080 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

Translin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Translin Antibody - BSA Free (NBP2-85979) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Translin. Peptide sequence: SRLSVNSVTAGDYSRPLHISTFINELDSGFRLLNLKNDSLRKRYDGLKYD The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TSN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Translin Antibody - BSA Free

• BCLF-1
• RCHF1
• recombination hotspot associated factor
• recombination hotspot-binding protein
• REHF-1
• TBRBP
• translin
• TRSLN

Background

Translin, also designated testis brain RNA-binding protein (TB-RBP), is a single-stranded DNA- and RNA-binding protein that binds to the 3' UTR regions (Y and H elements) of stored mRNAs, which suppresses their in vitro translation. The human translin gene maps to chromosome 2q21.1 and encodes a 26 kDa protein that has been highly conserved throughout evolution. Translin forms a ring-shaped structure, which is responsible for DNA binding, and also contains a leucine zipper motif, which is thought to enable translin to form dimers. Translin exports specific mRNAs out of the nucleus, supported by its localization in both the nuclei and cytoplasm of neurons, and regulates their translation. Association with Trax (translin-associated factor X), inhibits the binding of translin to RNA, but enhances its binding to single stranded DNA sequences. Breakpoints in the TLS/FUS and CHOP loci contain consensus recognition motifs of translin, which associates with chromosomal translocations in liposarcomas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TSN