TRAIP Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRAIP. Source: E. coli
Amino Acid Sequence: LNLPPVASETVDRLVLESPAPVEVNLKLRRPSFRDDIDLNATFDVDTPPARPSSSQHGYYEKLCLEKSHSPIQDVPKKICKGPRKESQLSL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
TRAIP |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48655. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for TRAIP Recombinant Protein Antigen
Background
The TNF receptor-associated factor (TRAF) family is a group of cytoplasmic adapter proteins that link a wide variety of cell surface receptors including the TNF and IL-1 receptor (TRNFR and IL-1R) superfamily to diverse signaling cascades involved in differentiation, proliferation, activation and apoptosis. TRIP (TRAF-interacting protein) was identified in 1997 as a component of receptor-TRAF signaling complexes (Lee, 1997). TRIP (also known as TRAIP) has been shown to associate with TRNFR2 or CD30 signaling complexes through its interaction with TRAF proteins and inhibit TRAF2-mediated NF-kB activation (Lee, 1997; Regamey et al, 2003). The recruitment of different TRAFs and TRAF associated proteins like TRIP to receptor complexes can help regulate and provide specificity to the intracellular signals triggered by the cell surface receptors.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Ca, Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: B/N, In vitro
Species: Hu
Applications: IP, PAGE
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Po, V-Vi
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, In vivo, RIA, WB
Species: Hu
Applications: ELISA
Species: Ma, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Publications for TRAIP Recombinant Protein Antigen (NBP2-48655PEP) (0)
There are no publications for TRAIP Recombinant Protein Antigen (NBP2-48655PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TRAIP Recombinant Protein Antigen (NBP2-48655PEP) (0)
There are no reviews for TRAIP Recombinant Protein Antigen (NBP2-48655PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for TRAIP Recombinant Protein Antigen (NBP2-48655PEP) (0)
Additional TRAIP Products
Research Areas for TRAIP Recombinant Protein Antigen (NBP2-48655PEP)
Find related products by research area.
|
Blogs on TRAIP