TRAF3IP2 Recombinant Protein Antigen

Images

 
There are currently no images for TRAF3IP2 Protein (NBP1-89263PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TRAF3IP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRAF3IP2.

Source: E. coli

Amino Acid Sequence: KQDVEGAESQLDEDEHGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRAF3IP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89263.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRAF3IP2 Recombinant Protein Antigen

  • ACT1DKFZP586G0522
  • adapter protein CIKS
  • C6orf2
  • C6orf4chromosome 6 open reading frame 5
  • C6orf5DKFZp586G0522
  • C6orf6MGC3581
  • CIKSchromosome 6 open reading frame 2
  • Connection to IKK and SAPK/JNK
  • NFkB-activating protein ACT1
  • Nuclear factor NF-kappa-B activator 1
  • TRAF3 interacting protein 2
  • TRAF3-interacting protein 2

Background

TRAF3IP2 encodes a protein involved in regulating responses to cytokines by members of the Rel/NF-kappaB transcription factor family. These factors play a central role in innate immunity in response to pathogens, inflammatory signals and stress. This gene product interacts with TRAF proteins (tumor necrosis factor receptor-associated factors) and either I-kappaB kinase or MAP kinase to activate either NF-kappaB or Jun kinase. Two alternative transcripts encoding different proteins have been identified. A third transcript, which does not encode a protein and is transcribed in the opposite orientation, has been identified. Overexpression of this transcript has been shown to reduce expression of at least one of the protein encoding transcripts, suggesting it has a regulatory role in the expression of this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY421
Species: Mu
Applications: ELISA
NBP2-26506
Species: Hu, Mu, Rt
Applications: B/N, In vitro
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
MAB177
Species: Hu
Applications: CyTOF-ready, Flow, KO, Neut, WB
NBP1-48284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF2214
Species: Hu
Applications: ICC, IHC, WB
NBP3-16602
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-89544
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
DMB00
Species: Hu
Applications: ELISA
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
DBLYS0B
Species: Hu
Applications: ELISA
NBP2-21037
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-2176
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-31361
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC,  IHC-P
NBP3-35061
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
DCDL40
Species: Hu
Applications: ELISA

Publications for TRAF3IP2 Protein (NBP1-89263PEP) (0)

There are no publications for TRAF3IP2 Protein (NBP1-89263PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAF3IP2 Protein (NBP1-89263PEP) (0)

There are no reviews for TRAF3IP2 Protein (NBP1-89263PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TRAF3IP2 Protein (NBP1-89263PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRAF3IP2 Products

Research Areas for TRAF3IP2 Protein (NBP1-89263PEP)

Find related products by research area.

Blogs on TRAF3IP2

There are no specific blogs for TRAF3IP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRAF3IP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAF3IP2