TRA2B Antibody (7A1)

Images

 
Western Blot: TRA2B Antibody (7A1) [H00006434-M01] - Analysis of SFRS10 expression in transfected 293T cell line by SFRS10 monoclonal antibody (M01), clone 7A1.Lane 1: SFRS10 transfected lysate(33.7 KDa).Lane 2: ...read more
Western Blot: TRA2B Antibody (7A1) [H00006434-M01] - Analysis of SFRS10 over-expressed 293 cell line, cotransfected with SFRS10 Validated Chimera RNAi ( Cat # H00006434-R01V ) (Lane 2) or non-transfected control (Lane ...read more
Sandwich ELISA: TRA2B Antibody (7A1) [H00006434-M01] - Detection limit for recombinant GST tagged SFRS10 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, RNAi, S-ELISA
Clone
7A1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TRA2B Antibody (7A1) Summary

Immunogen
SFRS10 (NP_004584, 120 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRP
Specificity
SFRS10 (7A1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRA2B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • RNA Inhibition
  • Sandwich ELISA
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA.
Publications
Read Publication using H00006434-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRA2B Antibody (7A1)

  • DKFZp686F18120
  • Htra2-beta
  • SFRS10
  • splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila)
  • Splicing factor, arginine/serine-rich 10
  • SRFS10
  • TRA-2 beta
  • TRA2-BETA
  • TRAN2B
  • transformer 2 beta homolog (Drosophila)
  • transformer 2 homolog
  • Transformer-2 protein homolog B
  • transformer-2 protein homolog beta
  • transformer-2-beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp, Ze
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
AF1458
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-31209
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86125
Species: Hu
Applications: IHC, IHC-P
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87784
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KO
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-32887
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56183
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00006428-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45429
Species: Hu
Applications: WB, IHC
NBP1-88376
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB110-38889
Species: Hu
Applications: WB, IP
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92343
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006434-M01
Species: Hu, Mu
Applications: WB, ELISA, RNAi, S-ELISA

Publications for TRA2B Antibody (H00006434-M01)(1)


Reviews for TRA2B Antibody (H00006434-M01) (0)

There are no reviews for TRA2B Antibody (H00006434-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRA2B Antibody (H00006434-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TRA2B Products

Bioinformatics Tool for TRA2B Antibody (H00006434-M01)

Discover related pathways, diseases and genes to TRA2B Antibody (H00006434-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRA2B Antibody (H00006434-M01)

Discover more about diseases related to TRA2B Antibody (H00006434-M01).
 

Pathways for TRA2B Antibody (H00006434-M01)

View related products by pathway.

PTMs for TRA2B Antibody (H00006434-M01)

Learn more about PTMs related to TRA2B Antibody (H00006434-M01).

Blogs on TRA2B

There are no specific blogs for TRA2B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRA2B Antibody (7A1) and receive a gift card or discount.

Bioinformatics

Gene Symbol TRA2B
Entrez
OMIM
Uniprot