TR2/NR2C1 Antibody

Images

 
Western Blot: TR2/NR2C1 Antibody [NBP2-55133] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: TR2/NR2C1 Antibody [NBP2-55133] - Staining of human cell line HEK 293 shows localization to nucleoplasm & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TR2/NR2C1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SQNSNEMSMIESLSNDDTSLCEFQEMQTNGDVSRAFDTLAKALNPGESTACQSSVAGMEGSVHLITGDSSINYTEKEGPLLSDS
Specificity
Specificity of human TR2/NR2C1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NR2C1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TR2/NR2C1 Recombinant Protein Antigen (NBP2-55133PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TR2/NR2C1 Antibody

  • NR2C1
  • nuclear receptor subfamily 2 group C member 1
  • nuclear receptor subfamily 2, group C isoform
  • nuclear receptor subfamily 2, group C, member 1
  • Orphan nuclear receptor TR2
  • Testicular receptor 2
  • TR2 nuclear hormone receptor
  • TR2
  • TR2-11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20619
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46228
Species: Hu
Applications: WB, IHC
NBP2-20571
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
MAB356
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-13674
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IP
NBP2-01863
Species: Hu
Applications: WB, IHC, IHC-P
NLS5060
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H8132-00
Species: Hu
Applications: WB, IHC, IP
NB100-56618
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-CS
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
NBP2-55133
Species: Hu
Applications: WB, ICC/IF

Publications for TR2/NR2C1 Antibody (NBP2-55133) (0)

There are no publications for TR2/NR2C1 Antibody (NBP2-55133).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TR2/NR2C1 Antibody (NBP2-55133) (0)

There are no reviews for TR2/NR2C1 Antibody (NBP2-55133). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TR2/NR2C1 Antibody (NBP2-55133) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TR2/NR2C1 Products

Bioinformatics Tool for TR2/NR2C1 Antibody (NBP2-55133)

Discover related pathways, diseases and genes to TR2/NR2C1 Antibody (NBP2-55133). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TR2/NR2C1 Antibody (NBP2-55133)

Discover more about diseases related to TR2/NR2C1 Antibody (NBP2-55133).
 

Pathways for TR2/NR2C1 Antibody (NBP2-55133)

View related products by pathway.

PTMs for TR2/NR2C1 Antibody (NBP2-55133)

Learn more about PTMs related to TR2/NR2C1 Antibody (NBP2-55133).

Blogs on TR2/NR2C1

There are no specific blogs for TR2/NR2C1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TR2/NR2C1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NR2C1