After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.
Western Blot: TR2/NR2C1 Antibody [NBP2-55133] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: TR2/NR2C1 Antibody [NBP2-55133] - Staining of human cell line HEK 293 shows localization to nucleoplasm & cytosol.
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SQNSNEMSMIESLSNDDTSLCEFQEMQTNGDVSRAFDTLAKALNPGESTACQSSVAGMEGSVHLITGDSSINYTEKEGPLLSDS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NR2C1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for TR2/NR2C1 Antibody - BSA Free
NR2C1
nuclear receptor subfamily 2 group C member 1
nuclear receptor subfamily 2, group C isoform
nuclear receptor subfamily 2, group C, member 1
Orphan nuclear receptor TR2
Testicular receptor 2
TR2 nuclear hormone receptor
TR2
TR2-11
Background
NR2C1 encodes a nuclear hormone receptor characterized by a highly conserved DNA binding domain (DBD), a variable hinge region, and a carboxy-terminal ligand binding domain (LBD) that is typical for all members of the steroid/thyroid hormone receptor superfamily. This protein also belongs to a large family of ligand-inducible transcription factors that regulate gene expression by binding to specific DNA sequences within promoters of target genes. Multiple alternatively spliced transcript variants have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our TR2/NR2C1 Antibody - BSA Free and receive a gift card or discount.