TPPP/p25 Antibody [DyLight 650]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 650

TPPP/p25 Antibody [DyLight 650] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-219 of human TPPP/p25 (NP_008961.1).
  
  Sequence:
  MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TPPP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for TPPP/p25 Antibody [DyLight 650]

• p24
• P24,25 kDa brain-specific protein
• p25
• p25alpha
• p25-alpha
• TPPP/p25brain specific protein p25 alpha
• TPPP1glycogen synthase kinase 3 (GSK3) inhibitor p24
• tubulin polymerization promoting protein
• tubulin polymerization-promoting protein

Background

TPPP may play a role in the polymerization of tubulin into microtubules, microtubule bundling and the stabilization of existing microtubules, thus maintaining the integrity ofthe microtubule network. May play a role in mitotic spindle assembly and nuclear env

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TPPP