TP53I11 Antibody - Azide and BSA Free

Western Blot: TP53I11 Antibody [NBP2-93452] - Western blot analysis of extracts of various cell lines, using TP53I11 antibody (NBP2-93452) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry-Paraffin: TP53I11 Antibody [NBP2-93452] - Paraffin-embedded rat spleen using TP53I11 .

Immunohistochemistry-Paraffin: TP53I11 Antibody [NBP2-93452] - Paraffin-embedded Human lymph node tumors using TP53I11 .

Immunohistochemistry-Paraffin: TP53I11 Antibody [NBP2-93452] - Paraffin-embedded mouse heart using TP53I11 .

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TP53I11 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit TP53I11 Antibody - Azide and BSA Free (NBP2-93452) is a polyclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human TP53I11 (NP_001245249.1). MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREPLGLRVWQFVSA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TP53I11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry 1:50-1:100
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for TP53I11 Antibody - Azide and BSA Free

• p53-induced protein
• PIG11p53-induced gene 11 protein
• tumor protein p53 inducible protein 11
• tumor protein p53-inducible protein 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: TP53I11