TP53I11 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TP53I11 Antibody [NBP2-32593] - Immunofluorescent staining of human cell line A549 shows localization to endoplasmic reticulum & the Golgi apparatus.
Immunohistochemistry-Paraffin: TP53I11 Antibody [NBP2-32593] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TP53I11 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TP53I11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TP53I11 Protein (NBP2-32593PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TP53I11 Antibody

  • p53-induced protein
  • PIG11p53-induced gene 11 protein
  • tumor protein p53 inducible protein 11
  • tumor protein p53-inducible protein 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5510
Species: Hu
Applications: WB
NBP2-57502
Species: Hu
Applications: ICC/IF
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
H00001617-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF4817
Species: Mu
Applications: WB
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87275
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06986
Species: Hu, Mu, Rt
Applications: WB, ELISA, EIA, IHC, IHC-P, PEP-ELISA
H00009802-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-89714
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF972
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-86899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for TP53I11 Antibody (NBP2-32593) (0)

There are no publications for TP53I11 Antibody (NBP2-32593).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TP53I11 Antibody (NBP2-32593) (0)

There are no reviews for TP53I11 Antibody (NBP2-32593). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TP53I11 Antibody (NBP2-32593) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TP53I11 Products

Bioinformatics Tool for TP53I11 Antibody (NBP2-32593)

Discover related pathways, diseases and genes to TP53I11 Antibody (NBP2-32593). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TP53I11 Antibody (NBP2-32593)

Discover more about diseases related to TP53I11 Antibody (NBP2-32593).
 

Pathways for TP53I11 Antibody (NBP2-32593)

View related products by pathway.

PTMs for TP53I11 Antibody (NBP2-32593)

Learn more about PTMs related to TP53I11 Antibody (NBP2-32593).

Blogs on TP53I11

There are no specific blogs for TP53I11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TP53I11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TP53I11