We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

TORC3/CRTC3 Recombinant Protein Antigen

Images

 
There are currently no images for TORC3/CRTC3 Protein (NBP1-83615PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TORC3/CRTC3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CRTC3.

Source: E. coli

Amino Acid Sequence: HGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CRTC3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83615.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TORC3/CRTC3 Recombinant Protein Antigen

  • CREB regulated transcription coactivator 3
  • CRTC3
  • FLJ21868
  • TORC3
  • TORC-3
  • TORC3CREB-regulated transcription coactivator 3
  • Transducer of CREB protein 3
  • transducer of regulated cAMP response element-binding protein (CREB) 3
  • Transducer of regulated cAMP response element-binding protein 3
  • transducer of regulated CREB protein 3

Background

Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMPresponse element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active whendephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 withTAF4. Regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. Potentcoactivator of PPARGC1A and inducer of mitochondrial biogenesis in muscle cells. Also coactivator for TAX activationof the human T-cell leukemia virus type 1 (HTLV-1) long terminal repeats (LTR)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-22356
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-89865
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF4439
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-92041
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-53228
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-04676
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
DY417
Species: Mu
Applications: ELISA
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
NB100-611
Species: Hu
Applications: IP, WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PA, Simple Western, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-45952
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00001392-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP2-67766
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
DBD00
Species: Hu
Applications: ELISA

Publications for TORC3/CRTC3 Protein (NBP1-83615PEP) (0)

There are no publications for TORC3/CRTC3 Protein (NBP1-83615PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TORC3/CRTC3 Protein (NBP1-83615PEP) (0)

There are no reviews for TORC3/CRTC3 Protein (NBP1-83615PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TORC3/CRTC3 Protein (NBP1-83615PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TORC3/CRTC3 Products

Blogs on TORC3/CRTC3

There are no specific blogs for TORC3/CRTC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TORC3/CRTC3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CRTC3