TORC3/CRTC3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

TORC3/CRTC3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CRTC3.
  
  

  Source: E. coli

  Amino Acid Sequence: HGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALN

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CRTC3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83615.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TORC3/CRTC3 Recombinant Protein Antigen

• CREB regulated transcription coactivator 3
• CRTC3
• FLJ21868
• TORC3
• TORC-3
• TORC3CREB-regulated transcription coactivator 3
• Transducer of CREB protein 3
• transducer of regulated cAMP response element-binding protein (CREB) 3
• Transducer of regulated cAMP response element-binding protein 3
• transducer of regulated CREB protein 3

Background

Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMPresponse element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active whendephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 withTAF4. Regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. Potentcoactivator of PPARGC1A and inducer of mitochondrial biogenesis in muscle cells. Also coactivator for TAX activationof the human T-cell leukemia virus type 1 (HTLV-1) long terminal repeats (LTR)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CRTC3