Recombinant Human TORC3/CRTC3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TORC3/CRTC3 Protein Summary

Description
TORC3/CRTC3 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: QDPYGGGGQSAWPAPYMGFCDGENNGHGEVASFPGPLKEENLLNVPKPLPKQLWETKEIQSLSGRPRSCDVGGGNAFPHNGQNLGLSPFLGTLNTGGSL
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
CRTC3

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TORC3/CRTC3 Protein

  • CREB regulated transcription coactivator 3
  • CRTC3
  • FLJ21868
  • TORC3
  • TORC-3
  • TORC3CREB-regulated transcription coactivator 3
  • Transducer of CREB protein 3
  • transducer of regulated cAMP response element-binding protein (CREB) 3
  • Transducer of regulated cAMP response element-binding protein 3
  • transducer of regulated CREB protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4439
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-29946
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-47649
Species: Hu
Applications: WB, Flow, IHC-P, PAGE, IF
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB100-611
Species: Hu
Applications: WB, IP
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
H00064784-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TORC3/CRTC3 Partial Recombinant Protein (H00064784-Q01) (0)

There are no publications for TORC3/CRTC3 Partial Recombinant Protein (H00064784-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TORC3/CRTC3 Partial Recombinant Protein (H00064784-Q01) (0)

There are no reviews for TORC3/CRTC3 Partial Recombinant Protein (H00064784-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TORC3/CRTC3 Partial Recombinant Protein (H00064784-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TORC3/CRTC3 Products

TORC3/CRTC3 H00064784-Q01

Bioinformatics Tool for TORC3/CRTC3 Partial Recombinant Protein (H00064784-Q01)

Discover related pathways, diseases and genes to TORC3/CRTC3 Partial Recombinant Protein (H00064784-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TORC3/CRTC3 Partial Recombinant Protein (H00064784-Q01)

Discover more about diseases related to TORC3/CRTC3 Partial Recombinant Protein (H00064784-Q01).
 

Pathways for TORC3/CRTC3 Partial Recombinant Protein (H00064784-Q01)

View related products by pathway.

PTMs for TORC3/CRTC3 Partial Recombinant Protein (H00064784-Q01)

Learn more about PTMs related to TORC3/CRTC3 Partial Recombinant Protein (H00064784-Q01).

Blogs on TORC3/CRTC3

There are no specific blogs for TORC3/CRTC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF
BDNF [Unconjugated]
248-BD-005/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TORC3/CRTC3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CRTC3
Entrez