TOR3A Antibody

Images

 
Western Blot: TOR3A Antibody [NBP1-89237] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-591
Immunohistochemistry-Paraffin: TOR3A Antibody [NBP1-89237] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TOR3A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NLRGDIINEVVLKLLKAGWSREEITMEHLEPHLQAEIVETIDNGFGHSRLVKENLIDYFIPFLPLEYRHVRLCARDA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOR3A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TOR3A Protein (NBP1-89237PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TOR3A Antibody

  • ADIR2
  • ADIRMGC111104
  • ATP-dependant interferon response protein 1
  • ATP-dependant interferon responsive
  • ATP-dependent interferon-responsive protein
  • FLJ22345
  • Torsin family 3 member A
  • torsin family 3, member A
  • torsin-3A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56137
Species: Hu
Applications: ICC/IF
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-56137
Species: Hu
Applications: ICC/IF
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15667
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84984
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-54851
Species: Hu
Applications: WB
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, PEP-ELISA
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-28641
Species: Hu, Mu, Rt, Mk
Applications: WB, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-89237
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TOR3A Antibody (NBP1-89237) (0)

There are no publications for TOR3A Antibody (NBP1-89237).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOR3A Antibody (NBP1-89237) (0)

There are no reviews for TOR3A Antibody (NBP1-89237). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TOR3A Antibody (NBP1-89237) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TOR3A Products

Bioinformatics Tool for TOR3A Antibody (NBP1-89237)

Discover related pathways, diseases and genes to TOR3A Antibody (NBP1-89237). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOR3A Antibody (NBP1-89237)

Discover more about diseases related to TOR3A Antibody (NBP1-89237).

Blogs on TOR3A

There are no specific blogs for TOR3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TOR3A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TOR3A