Recombinant Human TOR1AIP2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TOR1AIP2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-131 of Human IFRG15 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLVLPWSFPLEWAPQNLTRWTFEKACHPFLLGPPLVRKRIHDSRVAGFNPALQLILTRTDKTLNKKLGQNK

Protein/Peptide Type
Recombinant Protein
Gene
TOR1AIP2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TOR1AIP2 Protein

  • FLJ77012
  • IFRG15
  • interferon responsive gene 15
  • LULL1MGC120077
  • lumenal domain like LAP1
  • Lumenal domain-like LAP1
  • MGC120074
  • MGC120075
  • MGC120076
  • MGC126581
  • MGC138430
  • NET9
  • RP11-12M5.5
  • torsin A interacting protein 2
  • torsin-1A-interacting protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56137
Species: Hu
Applications: ICC/IF
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-49175
Species: Hu
Applications: WB, IHC
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB100-56654
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-59942
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-87396
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB120-2737
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NBP2-27199
Species: Hu, Eq, Pm
Applications: IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
H00064163-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for TOR1AIP2 Recombinant Protein (H00064163-P01) (0)

There are no publications for TOR1AIP2 Recombinant Protein (H00064163-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOR1AIP2 Recombinant Protein (H00064163-P01) (0)

There are no reviews for TOR1AIP2 Recombinant Protein (H00064163-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TOR1AIP2 Recombinant Protein (H00064163-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TOR1AIP2 Products

Bioinformatics Tool for TOR1AIP2 Recombinant Protein (H00064163-P01)

Discover related pathways, diseases and genes to TOR1AIP2 Recombinant Protein (H00064163-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOR1AIP2 Recombinant Protein (H00064163-P01)

Discover more about diseases related to TOR1AIP2 Recombinant Protein (H00064163-P01).
 

Pathways for TOR1AIP2 Recombinant Protein (H00064163-P01)

View related products by pathway.

Blogs on TOR1AIP2

There are no specific blogs for TOR1AIP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TOR1AIP2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TOR1AIP2