TOPORS Antibody - BSA Free

Western Blot: TOPORS Antibody [NBP3-35863] - Western blot analysis of various lysates using TOPORS Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3min.

• Reactivity: Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TOPORS Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TOPORS Antibody - BSA Free (NBP3-35863) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of mouse TOPORS (NP_598858.2).
  
  Sequence:
  PDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFTNPEVRRFRYRTTMTRERSASLYSPSST
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 117 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for TOPORS Antibody - BSA Free

• EC 6.3.2.-
• LUNtopoisomerase I binding, arginine/serine-rich
• p53-binding protein 3
• p53BP3
• retinitis pigmentosa 31 (autosomal dominant)
• RP31
• SUMO1-protein E3 ligase Topors
• topoisomerase I binding, arginine/serine-rich, E3 ubiquitin protein ligase
• Topoisomerase I-binding arginine/serine-rich protein
• Topoisomerase I-binding RING finger protein
• TP53BPLE3 ubiquitin-protein ligase Topors
• Tumor suppressor p53-binding protein 3

Background

TOPORS functions as an ubiquitin-protein E3 ligase and as an E3 SUMO1-protein ligase. Can both ubiquitinate and sumoylate p53

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.