Topoisomerase I Antibody (3D4W6)

Western Blot: Topoisomerase I Antibody (3D4W6) [NBP3-15450] - Western blot analysis of extracts of Mouse thymus, using DNA topoisomerase I (Topoisomerase I) Rabbit mAb (NBP3-15450) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

Immunohistochemistry-Paraffin: Topoisomerase I Antibody (3D4W6) [NBP3-15450] - Human thyroid cancer using DNA topoisomerase I (Topoisomerase I) Rabbit mAb (NBP3-15450) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunoprecipitation: Topoisomerase I Antibody (3D4W6) [NBP3-15450] - Immunoprecipitation analysis of 300ug extracts of MCF7 cells using 3ug Topoisomerase I antibody (NBP3-15450). Western blot was performed from the immunoprecipitate using Topoisomerase I antibody (NBP3-15450) at a dilition of 1:1000.

Western Blot: Topoisomerase I Antibody (3D4W6) [NBP3-15450] - Analysis of various lysates using DNA topoisomerase I (DNA topoisomerase I (TOP1)) Rabbit mAb at 1：1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 1s.

Immunocytochemistry/Immunofluorescence: Topoisomerase I Antibody (3D4W6) [NBP3-15450] - Confocal imaging of U-2 OS cells using DNA topoisomerase I (TOP1) Rabbit mAb (dilution 1:100)(Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: Topoisomerase I Antibody (3D4W6) [Topoisomerase I] - Confocal imaging of U-2 OS cells using Topoisomerase I Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC, IP
• Clone: 3D4W6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Topoisomerase I Antibody (3D4W6) Summary

• Description: Novus Biologicals Rabbit Topoisomerase I Antibody (3D4W6) (NBP3-15450) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Topoisomerase I (P11387). MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TOP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:200 - 1:1000
  • Immunohistochemistry 1:200 - 1:800
  • Immunohistochemistry-Paraffin 1:200 - 1:800
  • Immunoprecipitation 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
  • Western Blot 1:1000 - 1:6000
• Theoretical MW: 91 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Topoisomerase I Antibody (3D4W6)

• DNA topoisomerase 1
• DNA topoisomerase I
• EC 5.6.2.1
• EC 5.99.1.2
• TOP1
• TOPI
• topoisomerase (DNA) I
• Topoisomerase I
• type I DNA topoisomerase

Background

Topoisomerases are nuclear enzymes involved in a variety of cellular activities such as chromosome condensation, DNA replication, transcription, recombination and segregation at mitosis. Human topoisomerase I is a 100kD protein capable of relaxing positively and negatively supercoiled DNA by performing a transient single stranded nick which is then religated at the end of the reaction. It has been shown that the enzyme is located in regions of the genome that are undergoing active RNA synthesis, where it probably reduces superhelical stresses in the DNA, enabling RNA polymerase to function properly. Both DNA topoisomerases I and II have been found to be targets of autoantibodies in the sera of patients with certain autoimmune diseases such as systemic lupus erythematosus and also of some anti tumor drugs and antibiotics. Elevated levels of DNA topoisomerase I, detected by transfer assays, have been demonstrated in colorectal tumors compared with normal colon mucosa as a result of increased transcription or mRNA stability.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TOP1