TOMM34 Antibody - BSA Free

Immunohistochemistry-Paraffin: TOMM34 Antibody [NBP1-81655] - Staining in human testis and endometrium tissues using anti-TOMM34 antibody. Corresponding TOMM34 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: TOMM34 Antibody [NBP1-81655] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TOMM34 Antibody [NBP1-81655] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: TOMM34 Antibody [NBP1-81655] - Staining of human endometrium shows low expression as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TOMM34 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TOMM34 Antibody - BSA Free (NBP1-81655) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TOMM34
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TOMM34 Protein (NBP1-81655PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TOMM34 Antibody - BSA Free

• hTom34
• HTOM34P
• mitochondrial import receptor subunit TOM34
• outer mitochondrial membrane translocase (34kD)
• TOM34
• Translocase of outer membrane 34 kDa subunit
• translocase of outer mitochondrial membrane 34
• URCC3

Background

TOMM34 is encoded by this gene is involved in the import of precursor proteins into mitochondria. The encoded protein has a chaperone-like activity, binding the mature portion of unfolded proteins and aiding their import into mitochondria. This protein, which is found in the cytoplasm and sometimes associated with the outer mitochondrial membrane, has a weak ATPase activity and contains 6 TPR repeats.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TOMM34