TOMM20 Antibody

Images

 
Orthogonal Strategies: Western Blot: TOMM20 Antibody [NBP1-81556] - Analysis in human cell lines HEK293 and MCF-7. Corresponding TOMM20 RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody [NBP1-81556] - Z-stack confocal images with SRRF (super-resolution radial fluctuations) analysis of Tomm20, an outer mitochondrial membrane protein, in HeLa ...read more
Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556] - Staining of human duodenum shows moderate to strong positivity in mitochondria in glandular cells.
Western Blot: TOMM20 Antibody [NBP1-81556] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody [NBP1-81556] - RPE1 cells were fixed with 4% PFA, permeablized and blocked in 2.5% BSA with 0.2% Triton-X. Primary antibody was diluted 1:200 in PBS containing ...read more
Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody [NBP1-81556] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556] - Staining of human endometrium shows moderate to strong positivity in mitochondria in glandular cells.
Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556] - Staining of human prostate shows moderate to strong positivity in mitochondria in glandular cells.
Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556] - Staining of human cerebral cortex shows moderate to strong positivity in mitochondria in neurons.
Simple Western: TOMM20 Antibody [NBP1-81556] - Simple Western lane view shows a specific band for TOMM20 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: TOMM20 Antibody [NBP1-81556] - Electropherogram image(s) of corresponding Simple Western lane view. TOMM20 antibody was used at 1:30 dilution on RT-4 and U-251MG lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

TOMM20 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDV
Specificity
Specificity of human TOMM20 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOMM20
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Simple Western 1:30
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. TOMM20 antibody validated for ICC/IF from a verified customer review.
Control
TOMM20 Knockout 293T Cell Lysate
Control Peptide
TOMM20 Protein (NBP1-81556PEP)
Reviewed Applications
Read 3 Reviews rated 4.3
using
NBP1-81556 in the following applications:

Publications
Read Publications using
NBP1-81556 in the following applications:

  • 2 publications
  • IHC
    2 publications
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23704930).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TOMM20 Antibody

  • KIAA0016Outer mitochondrial membrane receptor Tom20
  • MAS20
  • MGC117367
  • Mitochondrial 20 kDa outer membrane protein
  • mitochondrial import receptor subunit TOM20 homolog
  • MOM19
  • TOM20
  • translocase of outer mitochondrial membrane 20 homolog (yeast)
  • translocase of outer mitochondrial membrane 20 homolog type II

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00056993-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
NBP2-38289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-695
Species: Hu, Mu, Rt, Bv, Fi
Applications: WB, ELISA, IHC, KD
NBP1-80681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00892
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP3-04865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-44318
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF3145
Species: Hu
Applications: WB
NBL1-17193
Species: Hu
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NBP2-75597
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-71648
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
NBP1-77397
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, KD
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP

Publications for TOMM20 Antibody (NBP1-81556)(7)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(2)
IHC
(2)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(2)
Rat
(1)
All Species
Showing Publications 1 - 7 of 7.
Publications using NBP1-81556 Applications Species
Ghosh P, Guo Y, Ashrafi A et al. Oxygen-enhanced optoacoustic tomography reveals the effectiveness of targeting heme and oxidative phosphorylation at normalizing tumor vascular oxygenation Cancer Res. Jun 16 2020 [PMID: 32546631] (IHC, Human) IHC Human
Li B, Zhao H, Wu Y et al. Mitochondrial-Derived Vesicles Protect Cardiomyocytes Against Hypoxic Damage Front Cell Dev Biol Apr 17 2020 [PMID: 32426351] (ICC/IF, Rat) ICC/IF Rat
Iannielli A, Ugolini GS, Cordiglieri C, et al. Reconstitution of the Human Nigro-striatal Pathway on-a-Chip Reveals OPA1-Dependent Mitochondrial Defects and Loss of Dopaminergic Synapses Cell Rep Dec 24 2019 [PMID: 31875567] (IHC) IHC
Sala, D;Cunningham, TJ;Stec, MJ;Etxaniz, U;Nicoletti, C;Dall'Agnese, A;Puri, PL;Duester, G;Latella, L;Sacco, A; The Stat3-Fam3a axis promotes muscle stem cell myogenic lineage progression by inducing mitochondrial respiration Nat Commun Apr 17 2019 [PMID: 30996264] (ICC/IF, Mouse) ICC/IF Mouse
Ward JM, Stoyas CA, Switonski PM et al. Metabolic and Organelle Morphology Defects in Mice and Human Patients Define Spinocerebellar Ataxia Type 7 as a Mitochondrial Disease Cell Rep Jan 29 2019 [PMID: 30699348] (WB, Mouse) WB Mouse
Weber TA, Koob S, Heide H et al. APOOL Is a Cardiolipin-Binding Constituent of the Mitofilin/MINOS Protein Complex Determining Cristae Morphology in Mammalian Mitochondria. PLoS One 2013 [PMID: 23704930]
Stadler C, Hjelmare M, Neumann B et al. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. J Proteomics 2012 Apr [PMID: 22361696]

Reviews for TOMM20 Antibody (NBP1-81556) (3) 4.33

Average Rating: 4.3
(Based on 3 reviews)
We have 3 reviews tested in 2 species: Human, Human and Mouse.

Reviews using NBP1-81556:
Filter by Applications
ICC
(2)
WB
(1)
All Applications
Filter by Species
Human
(2)
Human and Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry TOMM20 NBP1-81556
Enlarge
4
reviewed by:
Anonymous
ICC Human 10/31/2020
View

Summary

ApplicationImmunocytochemistry
Sample TestedHuman primary fibroblast
SpeciesHuman
Lote118816

Comments

CommentsPFA 4% 15 min fixed. Ab incubation:1:200 dilution O/N 4ÂșC in 10% Donkey Serum in PBST (0.1% Triton). Secondary antibody Donkey anti-rabbit Alexa Fluor 488 1:500 2h RT in 10% Donkey Serum in PBST (0.1% Triton).
Western Blot TOMM20 NBP1-81556
Enlarge
5
reviewed by:
Anonymous
WB Human and Mouse 06/29/2017
View

Summary

ApplicationWestern Blot
Sample Tested293FT cell lysate,nih3t3 cell lysate
SpeciesHuman and Mouse
Lotb105898
Immunocytochemistry TOMM20 NBP1-81556
Enlarge
4
reviewed by:
Steve Gillmore
ICC Human 04/10/2017
View

Summary

ApplicationImmunocytochemistry
Sample TestedRetinal Pigmented Epithelial Cells
SpeciesHuman

Comments

CommentsRPE1 cells were fixed with 4% PFA, permeablized and blocked in 2.5% BSA with 0.2% Triton-X. Primary antibody was diluted 1:200 in PBS containing 2.5% BSA overnight at 4 deg C. Cells were incubated with anti-rabbit secondary antibody and counterstained with hoescht 33342. Image was collected using Zeiss 780 LSM.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TOMM20 Antibody (NBP1-81556) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TOMM20 Products

Bioinformatics Tool for TOMM20 Antibody (NBP1-81556)

Discover related pathways, diseases and genes to TOMM20 Antibody (NBP1-81556). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOMM20 Antibody (NBP1-81556)

Discover more about diseases related to TOMM20 Antibody (NBP1-81556).
 

Pathways for TOMM20 Antibody (NBP1-81556)

View related products by pathway.

PTMs for TOMM20 Antibody (NBP1-81556)

Learn more about PTMs related to TOMM20 Antibody (NBP1-81556).

Blogs on TOMM20.

Parkin - Role in Mitochondrial Quality Control and Parkinson's Disease
Parkin/PARK2 is a cytosolic enzyme which gets recruited to cellular mitochondria damaged through depolarization, ROS or unfolded proteins accumulation, and exert protective effects by inducing mitophagy (mitochondrial autophagy). Parkin induces mit...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.3
5
1
4
2
3
0
2
0
1
0

Anonymous
10/31/2020
Application: ICC
Species: Human

Anonymous
06/29/2017
Application: WB
Species: Human and Mouse

Steve Gillmore
04/10/2017
Application: ICC
Species: Human

Bioinformatics

Gene Symbol TOMM20