TOMM20 Antibody

Western Blot: TOMM20 Antibody [NBP1-81556] - Analysis in human cell lines HEK293 and MCF-7. Corresponding TOMM20 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

Immunocytochemistry/Immunofluorescence: TOMM20 Antibody [NBP1-81556] - Z-stack confocal images with SRRF (super-resolution radial fluctuations) analysis of Tomm20, an outer mitochondrial membrane protein, in HeLa cells. Tomm20 was detected in HeLa cells using 1 ug/ml Rb anti-Tomm20 (NBP1-81556) and 1:500 JF646-conjugated anti-Rb secondary antibody (red). Cells were counterstained with Dapi (blue). Image submitted by a verified customer review.

Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556] - Staining of human duodenum shows moderate to strong positivity in mitochondria in glandular cells.

Western Blot: TOMM20 Antibody [NBP1-81556] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: TOMM20 Antibody [NBP1-81556] - RPE1 cells were fixed with 4% PFA, permeablized and blocked in 2.5% BSA with 0.2% Triton-X. Primary antibody was diluted 1:200 in PBS containing 2.5% BSA overnight at 4 deg C. Cells were incubated with anti-rabbit secondary antibody and counterstained with hoescht 33342. Image was collected using Zeiss 780 LSM. Image submitted by a verified customer review.

Immunocytochemistry/Immunofluorescence: TOMM20 Antibody [NBP1-81556] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556] - Staining of human endometrium shows moderate to strong positivity in mitochondria in glandular cells.

Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556] - Staining of human prostate shows moderate to strong positivity in mitochondria in glandular cells.

Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556] - Staining of human cerebral cortex shows moderate to strong positivity in mitochondria in neurons.

Simple Western: TOMM20 Antibody [NBP1-81556] - Simple Western lane view shows a specific band for TOMM20 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: TOMM20 Antibody [NBP1-81556] - Electropherogram image(s) of corresponding Simple Western lane view. TOMM20 antibody was used at 1:30 dilution on RT-4 and U-251MG lysate(s).

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

TOMM20 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDV
• Specificity: Specificity of human TOMM20 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TOMM20
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04-0.4 ug/ml
  • Simple Western 1:30
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. TOMM20 antibody validated for ICC/IF from a verified customer review.
• Control:

  TOMM20 Knockout 293T Cell Lysate

• Control Peptide:

  TOMM20 Protein (NBP1-81556PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23704930).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TOMM20 Antibody

• KIAA0016Outer mitochondrial membrane receptor Tom20
• MAS20
• MGC117367
• Mitochondrial 20 kDa outer membrane protein
• mitochondrial import receptor subunit TOM20 homolog
• MOM19
• TOM20
• translocase of outer mitochondrial membrane 20 homolog (yeast)
• translocase of outer mitochondrial membrane 20 homolog type II

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TOMM20 Antibody (NBP1-81556)(7)

Publications using NBP1-81556

• Ghosh P, Guo Y, Ashrafi A et al. Oxygen-enhanced optoacoustic tomography reveals the effectiveness of targeting heme and oxidative phosphorylation at normalizing tumor vascular oxygenation Cancer Res. Jun 16 2020 [PMID: 32546631] (IHC, Human)
• Li B, Zhao H, Wu Y et al. Mitochondrial-Derived Vesicles Protect Cardiomyocytes Against Hypoxic Damage Front Cell Dev Biol Apr 17 2020 [PMID: 32426351] (ICC/IF, Rat)
• Iannielli A, Ugolini GS, Cordiglieri C, et al. Reconstitution of the Human Nigro-striatal Pathway on-a-Chip Reveals OPA1-Dependent Mitochondrial Defects and Loss of Dopaminergic Synapses Cell Rep Dec 24 2019 [PMID: 31875567] (IHC)
• Sala, D;Cunningham, TJ;Stec, MJ;Etxaniz, U;Nicoletti, C;Dall'Agnese, A;Puri, PL;Duester, G;Latella, L;Sacco, A; The Stat3-Fam3a axis promotes muscle stem cell myogenic lineage progression by inducing mitochondrial respiration Nat Commun Apr 17 2019 [PMID: 30996264] (ICC/IF, Mouse)
• Ward JM, Stoyas CA, Switonski PM et al. Metabolic and Organelle Morphology Defects in Mice and Human Patients Define Spinocerebellar Ataxia Type 7 as a Mitochondrial Disease Cell Rep Jan 29 2019 [PMID: 30699348] (WB, Mouse)
• Weber TA, Koob S, Heide H et al. APOOL Is a Cardiolipin-Binding Constituent of the Mitofilin/MINOS Protein Complex Determining Cristae Morphology in Mammalian Mitochondria. PLoS One 2013 [PMID: 23704930]
• Stadler C, Hjelmare M, Neumann B et al. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. J Proteomics 2012 Apr [PMID: 22361696]

Reviews for TOMM20 Antibody (NBP1-81556) (3)

Average Rating: 4.3

(Based on 3 reviews)

We have 3 reviews tested in 2 species: Human, Human and Mouse.

reviewed by: Anonymous ICC Human 10/31/2020

Summary

• Application: Immunocytochemistry
• Sample Tested: Human primary fibroblast
• Species: Human
• Lot: e118816

Comments

• Comments: PFA 4% 15 min fixed. Ab incubation:1:200 dilution O/N 4ºC in 10% Donkey Serum in PBST (0.1% Triton). Secondary antibody Donkey anti-rabbit Alexa Fluor 488 1:500 2h RT in 10% Donkey Serum in PBST (0.1% Triton).

reviewed by: Anonymous WB Human and Mouse 06/29/2017

Summary

• Application: Western Blot
• Sample Tested: 293FT cell lysate,nih3t3 cell lysate
• Species: Human and Mouse
• Lot: b105898

reviewed by: Steve Gillmore ICC Human 04/10/2017

Summary

• Application: Immunocytochemistry
• Sample Tested: Retinal Pigmented Epithelial Cells
• Species: Human

Comments

• Comments: RPE1 cells were fixed with 4% PFA, permeablized and blocked in 2.5% BSA with 0.2% Triton-X. Primary antibody was diluted 1:200 in PBS containing 2.5% BSA overnight at 4 deg C. Cells were incubated with anti-rabbit secondary antibody and counterstained with hoescht 33342. Image was collected using Zeiss 780 LSM.

Bioinformatics

• Gene Symbol: TOMM20