TOM70 Recombinant Protein Antigen (NBP2-38571PEP)

Images

 
There are currently no images for TOM70 Protein (NBP2-38571PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TOM70 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TOMM70A.

Source: E.coli

Amino Acid Sequence: YTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLEDVTAVCILEGFQNQQSMLLADKVLKLLGKEKAKEKYKNREPLMPSPQFIKS

Protein/Peptide Type
Recombinant Protein Antigen
Gene
TOMM70A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38571.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TOM70 Recombinant Protein Antigen

  • FLJ90470
  • KIAA0719
  • mitochondrial import receptor subunit TOM70
  • Mitochondrial precursor proteins import receptor
  • TOM70
  • Translocase of outer membrane 70 kDa subunit
  • translocase of outer mitochondrial membrane 70 (yeast) homolog A
  • translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae)
  • translocase of outer mitochondrial membrane 70 homolog A (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81556
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-80671
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NB100-695
Species: Hu, Mu, Rt, Po, Av, Bv, Fi, Gt, Ma, Re
Applications: WB, ELISA, IHC
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
MAB8864
Species: Hu
Applications: IHC
NBP1-84509
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for TOM70 Protein (NBP2-38571PEP) (0)

There are no publications for TOM70 Protein (NBP2-38571PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOM70 Protein (NBP2-38571PEP) (0)

There are no reviews for TOM70 Protein (NBP2-38571PEP). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for TOM70 Protein (NBP2-38571PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TOM70 Products

Related Products by Gene

Bioinformatics Tool for TOM70 Protein (NBP2-38571PEP)

Discover related pathways, diseases and genes to TOM70 Protein (NBP2-38571PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOM70 Protein (NBP2-38571PEP)

Discover more about diseases related to TOM70 Protein (NBP2-38571PEP).
 

Pathways for TOM70 Protein (NBP2-38571PEP)

View related products by pathway.

PTMs for TOM70 Protein (NBP2-38571PEP)

Learn more about PTMs related to TOM70 Protein (NBP2-38571PEP).
 

Research Areas for TOM70 Protein (NBP2-38571PEP)

Find related products by research area.

Blogs on TOM70

There are no specific blogs for TOM70, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TOM70 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TOMM70A

Customers Who Bought This Also Bought

TOM70 Antibody
NB110-58347
TOM70 Antibody
NB110-58347
TOM70 Antibody
NB110-58347
TOMM20 Antibody
NBP1-81556
TOMM20 Antibody
NBP1-81556
TOMM20 Antibody
NBP1-81556