Recombinant Human TOM1L1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human TOM1L1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human TOM1L1

Source: Wheat Germ

Amino Acid Sequence: MAFGKSHRDPYATSVGHLIEKATFAGVQTEDWGQFMHICDIINTTQDAPKDAVKALKKRISKNYNHKEIQLTLSLIDMCVQNCGPSFQSLIVKKEFVKEN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TOM1L1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TOM1L1 Protein

  • OK/KNS-CL.3
  • Src-activating and signaling molecule protein
  • SRCASMSrc activating and signaling molecule
  • target of myb 1-like 1
  • target of myb1 (chicken) homolog-like 1
  • target of myb1 (chicken)-like 1
  • target of myb1-like 1
  • Target of Myb-like protein 1
  • TOM1-like protein 1

Background

TOM1L1 - target of myb1-like 1 (chicken)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86170
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-86006
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56533
Species: Hu
Applications: WB
NBP1-92381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-866
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-81597
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22212
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP2-34136
Species: Hu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-67504
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP

Publications for TOM1L1 Partial Recombinant Protein (H00010040-Q01) (0)

There are no publications for TOM1L1 Partial Recombinant Protein (H00010040-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOM1L1 Partial Recombinant Protein (H00010040-Q01) (0)

There are no reviews for TOM1L1 Partial Recombinant Protein (H00010040-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TOM1L1 Partial Recombinant Protein (H00010040-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TOM1L1 Products

Bioinformatics Tool for TOM1L1 Partial Recombinant Protein (H00010040-Q01)

Discover related pathways, diseases and genes to TOM1L1 Partial Recombinant Protein (H00010040-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOM1L1 Partial Recombinant Protein (H00010040-Q01)

Discover more about diseases related to TOM1L1 Partial Recombinant Protein (H00010040-Q01).
 

Pathways for TOM1L1 Partial Recombinant Protein (H00010040-Q01)

View related products by pathway.

PTMs for TOM1L1 Partial Recombinant Protein (H00010040-Q01)

Learn more about PTMs related to TOM1L1 Partial Recombinant Protein (H00010040-Q01).

Blogs on TOM1L1

There are no specific blogs for TOM1L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TOM1L1 Antibody
NBP2-20680

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TOM1L1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TOM1L1