Recombinant Human TOM1L1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human TOM1L1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human TOM1L1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAFGKSHRDPYATSVGHLIEKATFAGVQTEDWGQFMHICDIINTTQDAPKDAVKALKKRISKNYNHKEIQLTLSLIDMCVQNCGPSFQSLIVKKEFVKEN

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TOM1L1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TOM1L1 GST (N-Term) Protein

  • OK/KNS-CL.3
  • Src-activating and signaling molecule protein
  • SRCASMSrc activating and signaling molecule
  • target of myb 1-like 1
  • target of myb1 (chicken) homolog-like 1
  • target of myb1 (chicken)-like 1
  • target of myb1-like 1
  • Target of Myb-like protein 1
  • TOM1-like protein 1

Background

TOM1L1 - target of myb1-like 1 (chicken)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86170
Species: Hu
Applications: IHC, IHC-P, WB
NB500-517
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
236-EG
Species: Hu
Applications: BA
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-86006
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00009146-M01
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, KD, S-ELISA, WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89490
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-38514
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00006430-B01P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-15638
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-81597
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-90078
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88650
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP2-67488
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-34136
Species: Hu
Applications: IHC, IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
MAB6777
Species: Hu
Applications: ICC, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-34270
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western

Publications for TOM1L1 Partial Recombinant Protein (H00010040-Q01) (0)

There are no publications for TOM1L1 Partial Recombinant Protein (H00010040-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOM1L1 Partial Recombinant Protein (H00010040-Q01) (0)

There are no reviews for TOM1L1 Partial Recombinant Protein (H00010040-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TOM1L1 Partial Recombinant Protein (H00010040-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TOM1L1 Products

Bioinformatics Tool for TOM1L1 Partial Recombinant Protein (H00010040-Q01)

Discover related pathways, diseases and genes to TOM1L1 Partial Recombinant Protein (H00010040-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOM1L1 Partial Recombinant Protein (H00010040-Q01)

Discover more about diseases related to TOM1L1 Partial Recombinant Protein (H00010040-Q01).
 

Pathways for TOM1L1 Partial Recombinant Protein (H00010040-Q01)

View related products by pathway.

PTMs for TOM1L1 Partial Recombinant Protein (H00010040-Q01)

Learn more about PTMs related to TOM1L1 Partial Recombinant Protein (H00010040-Q01).

Blogs on TOM1L1

There are no specific blogs for TOM1L1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TOM1L1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TOM1L1