TOM1 Antibody - BSA Free

Western Blot: TOM1 Antibody [NBP3-38601] - Western blot analysis of various lysates using TOM1 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TOM1 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 314-493 of human TOM1 (NP_001129204.1).
  
  Sequence:
  SEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGAIPVTQACLMEDIEQWLSTDVGNDAEEPKGVTSEGKFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLFAL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TOM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 54 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for TOM1 Antibody - BSA Free

• ADP-ribosylation factor-binding protein GGA3
• golgi associated, gamma adaptin ear containing, ARF binding protein 3
• golgi-associated, gamma adaptin ear containing, ARF binding protein 3
• KIAA0154Golgi-localized, gamma ear-containing, ARF-binding protein 3

Background

The specific function of this gene has not yet been determined, yet it may involve the translocation of growth factor receptor complexes to the lysosome for degradation. This gene is localized to 22q13.1, with HMOX1 and MCM5 distally and HMG2L1 proximally positioned.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TOM1