TOM1 Antibody

Images

 
Western Blot: TOM1 Antibody [NBP2-55152] - Western blot analysis in human cell line RT-4, human cell line EFO-21, human cell line A-431, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: TOM1 Antibody [NBP2-55152] - Staining of human cell line U-2 OS shows localization to cytosol.
Western Blot: TOM1 Antibody [NBP2-55152] - Analysis in human cell line U-87 MG.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TOM1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQ
Specificity
Specificity of human TOM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOM1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TOM1 Recombinant Protein Antigen (NBP2-55152PEP)

Reactivity Notes

Rat 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TOM1 Antibody

  • ADP-ribosylation factor-binding protein GGA3
  • golgi associated, gamma adaptin ear containing, ARF binding protein 3
  • golgi-associated, gamma adaptin ear containing, ARF binding protein 3
  • KIAA0154Golgi-localized, gamma ear-containing, ARF-binding protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009146-M01
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, RNAi, S-ELISA
NBP2-38514
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90044
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-81597
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-20680
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86006
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-652
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-112
Species: Hu, Mu, Rt, Ha, Pm, Pm
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-81516
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TOM1 Antibody (NBP2-55152) (0)

There are no publications for TOM1 Antibody (NBP2-55152).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOM1 Antibody (NBP2-55152) (0)

There are no reviews for TOM1 Antibody (NBP2-55152). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TOM1 Antibody (NBP2-55152) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TOM1 Products

Bioinformatics Tool for TOM1 Antibody (NBP2-55152)

Discover related pathways, diseases and genes to TOM1 Antibody (NBP2-55152). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOM1 Antibody (NBP2-55152)

Discover more about diseases related to TOM1 Antibody (NBP2-55152).
 

Pathways for TOM1 Antibody (NBP2-55152)

View related products by pathway.

PTMs for TOM1 Antibody (NBP2-55152)

Learn more about PTMs related to TOM1 Antibody (NBP2-55152).

Blogs on TOM1

There are no specific blogs for TOM1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TOM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TOM1