TOM1 Antibody

Images

 
Western Blot: TOM1 Antibody [NBP1-86170] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-431. Lane 5: Human liver tissue. ...read more
Immunohistochemistry-Paraffin: TOM1 Antibody [NBP1-86170] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TOM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTR
Specificity
Specificity of human TOM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TOM1 Protein (NBP1-86170PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TOM1 Antibody

  • ADP-ribosylation factor-binding protein GGA3
  • golgi associated, gamma adaptin ear containing, ARF binding protein 3
  • golgi-associated, gamma adaptin ear containing, ARF binding protein 3
  • KIAA0154Golgi-localized, gamma ear-containing, ARF-binding protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83202
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56533
Species: Hu
Applications: WB
NBP1-92381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81597
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20680
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86006
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-652
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81516
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TOM1 Antibody (NBP1-86170) (0)

There are no publications for TOM1 Antibody (NBP1-86170).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOM1 Antibody (NBP1-86170) (0)

There are no reviews for TOM1 Antibody (NBP1-86170). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TOM1 Antibody (NBP1-86170) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TOM1 Antibody (NBP1-86170)

Discover related pathways, diseases and genes to TOM1 Antibody (NBP1-86170). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOM1 Antibody (NBP1-86170)

Discover more about diseases related to TOM1 Antibody (NBP1-86170).
 

Pathways for TOM1 Antibody (NBP1-86170)

View related products by pathway.

PTMs for TOM1 Antibody (NBP1-86170)

Learn more about PTMs related to TOM1 Antibody (NBP1-86170).

Blogs on TOM1

There are no specific blogs for TOM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TOM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TOM1