TOB2 Antibody - BSA Free

Western Blot: TOB2 Antibody [NBP2-93026] - Analysis of extracts of various cell lines, using TOB2 . Exposure time: 30s.

Immunohistochemistry-Paraffin: TOB2 Antibody [NBP2-93026] - Paraffin-embedded mouse lung using TOB2 .

Immunohistochemistry-Paraffin: TOB2 Antibody [NBP2-93026] - Paraffin-embedded human liver damage using TOB2 .

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TOB2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TOB2 Antibody - BSA Free (NBP2-93026) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human TOB2 (NP_057356.1). MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPLKGSGFRCVHIGEMVDPVVEL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TOB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:100-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TOB2 Antibody - BSA Free

• bK223H9
• protein Tob2
• Protein Tob4
• TOB4KIAA1663
• TOBL
• Transducer of erbB-2 2
• transducer of ERBB2, 2
• TROB2

Background

TOB2 belongs to the TOB (see TOB1; MIM 605523)/BTG1 (MIM 109580) family of antiproliferative proteins, which are involved in the regulation of cell cycle progression.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TOB2