CNOT6L Antibody


Western Blot: CNOT6L Antibody [NBP3-10696] - Western blot analysis of CNOT6L in HepG2 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CNOT6L Antibody Summary

The immunogen is a synthetic peptide directed towards the middle region of Human CNOT6L. Peptide sequence AKIMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQVAMANSDGSEAMLN
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS buffer, 2% sucrose.
0.09% Sodium Azide
Affinity purified

Alternate Names for CNOT6L Antibody

  • Carbon catabolite repressor protein 4 homolog B
  • CCR4b
  • CCR4-NOT transcription complex subunit 6-like
  • CCR4-NOT transcription complex, subunit 6-like
  • DKFZp434K098
  • EC 3.1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu
Applications: ICC/IF, IP, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB

Publications for CNOT6L Antibody (NBP3-10696) (0)

There are no publications for CNOT6L Antibody (NBP3-10696).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNOT6L Antibody (NBP3-10696) (0)

There are no reviews for CNOT6L Antibody (NBP3-10696). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CNOT6L Antibody (NBP3-10696) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CNOT6L Products

Array NBP3-10696

Bioinformatics Tool for CNOT6L Antibody (NBP3-10696)

Discover related pathways, diseases and genes to CNOT6L Antibody (NBP3-10696). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNOT6L Antibody (NBP3-10696)

Discover more about diseases related to CNOT6L Antibody (NBP3-10696).

Pathways for CNOT6L Antibody (NBP3-10696)

View related products by pathway.

PTMs for CNOT6L Antibody (NBP3-10696)

Learn more about PTMs related to CNOT6L Antibody (NBP3-10696).

Blogs on CNOT6L

There are no specific blogs for CNOT6L, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CNOT6L Antibody and receive a gift card or discount.


Gene Symbol CNOT6L