New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Home » TNRC4 » TNRC4 Antibodies » TNRC4 Antibody

TNRC4 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: TNRC4 Antibody [NBP2-83704] - WB Suggested Anti-TNRC4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Jurkat cell lysate
Western Blot: TNRC4 Antibody [NBP2-83704] - WB Suggested Anti-TNRC4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Jurkat cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TNRC4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human TNRC4. Peptide sequence: MKEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGC The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CELF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TNRC4 Antibody

  • BRUNOL1CAG repeat protein 4
  • CAG/CTG 4
  • CAGH4CUG-BP- and ETR-3-like factor 3
  • CELF-3
  • CUGBP, Elav-like family member 3
  • ERDA4ELAV-type RNA-binding protein 1
  • ETR-1
  • MGC57297
  • TNRC4RNA-binding protein BRUNOL-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CUGBP1/CELF1
Antibody (3B1)
NB200-316
Immunohistochemistry-Paraffin: CUGBP1/CELF1 Antibody (3B1) [NB200-316] - IHC analysis of a formalin fixed paraffin-embedded (FFPE) human spleen using 1:100 conc. of CUGBP1/CELF1 antibody on a Bond Rx autostainer (Leica Biosystems). The assay involved 30 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 9.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 15 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Nuclear staining was observed in lymphocytes.
Flow Cytometry: CUGBP1 Antibody (3B1) [NB200-316] - Intracellular flow cytometric staining of 1 x 10^6 MCF-7 cells using CUGBP1 antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
Simple Western: CUGBP1 Antibody (3B1) [NB200-316] - Simple Western lane view shows a specific band for CUGBP1 in 0.5 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(12 Publications)
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
CEBP Delta Antibody
NB110-85519
Western Blot: CEBP Delta Antibody [NB110-85519] - Lane 1: untreated wild-type (WT) cells. Lane 2: WT cells treated 3 hrs with LPS. Lane 3: C/EBPd-knock-out cells treated 3 hrs with LPS. 35 ug per lane. Primary: anti-C/EBPd antibody at 1:15k overnight at 4C. Blocking: buffer TBST ECL was used for detection of endogenous protein in whole cell extracts from mouse primary macrophage cells. Predicted/Observed size: 28.8 kDa, 35 kDa.
Western Blot: CEBP Delta Antibody [NB110-85519] - Lane 1: Human C/EBPbeta. Lane 2: Mouse C/EBPdelta. Lane 3: untransfected. Lane 4: Human C/EBPdelta. 35 ug per lane. Primary: Anti-C/EBPd antibody at 1:15k overnight at 4C. Blocking: buffer TBST ECL was used for detection of overexpressed protein in human and mouse C/EBP delta. Predicted/Observed size: 28.8 kDa, 35 kDa.
Western Blot: CEBP Delta Antibody [NB110-85519] - Detection of endogenous protein in whole cell extracts from mouse macrophage cells. Untreated WT cells (Lane 1), WT cells treated 3 hrs with LPS (Lane 2) and knock-out cells treated 3 hrs with LPS (Lane 3). The band at ~35 kDa, indicated by the arrowhead, corresponds to the expected molecular weight of endogenous C/EBP delta. Primary antibody at 1:15,000. ECL was used for detection.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IP, KD, WB
Huntingtin Antibody
NBP3-13106
Western Blot: Huntingtin Antibody [NBP3-13106] - Various whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with Huntingtin antibody (NBP3-13106) diluted at 1:1000.
Immunohistochemistry-Paraffin: Huntingtin Antibody [NBP3-13106] - Huntingtin antibody detects Huntingtin protein at cytoplasm in rat brain by immunohistochemical analysis. Sample: Paraffin-embedded rat brain. Huntingtin antibody (NBP3-13106) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunocytochemistry/Immunofluorescence: Huntingtin Antibody [NBP3-13106] - Huntingtin antibody detects Huntingtin protein at cytoplasm by immunofluorescent analysis. Sample: SK-N-SH cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Huntingtin protein stained by Huntingtin antibody (NBP3-13106) diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
BRUNOL4 Antibody
NBP1-89932
Immunohistochemistry-Paraffin: BRUNOL4 Antibody [NBP1-89932] - Analysis in human cerebral cortex and kidney tissues using NBP1-89932 antibody. Corresponding CELF4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: BRUNOL4 Antibody [NBP1-89932] - Staining of human duodenum shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: BRUNOL4 Antibody [NBP1-89932] - Staining of human kidney shows no positivity in cells in tubules as expected.
(2 Publications)
Species: Hu
Applications: IHC, IHC-P
CUGBP2 Antibody
NBP2-16035
Immunohistochemistry-Paraffin: CUGBP2 Antibody [NBP2-16035] - Paraffin-embedded mouse brain. CUGBP2 antibody [N1N3] diluted at 1:500.
Western Blot: CUGBP2 Antibody [NBP2-16035] - Sample (30 ug of whole cell lysate) A: NT2D1 7. 5% SDS PAGE gel, diluted at 1:3000.
Immunohistochemistry-Paraffin: CUGBP2 Antibody [NBP2-16035] - Immunohistochemical analysis of paraffin-embedded RT2 xenograft, using antibody at 1:500 dilution.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DMPK Antibody
(713931)
MAB6967
Western blot shows lysates of human heart tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human DMPK Monoclonal Antibody (Catalog # MAB6967) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for DMPK at approximately 74 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
Transglutaminase
1/TGM1 Antibody
NBP2-34062
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human esophagus shows high expression.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Analysis in human esophagus and colon tissues. Corresponding TGM1 RNA-seq data are presented for the same tissues.
Western Blot: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Analysis in human tonsil tissue.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Tau [p Thr181]
Antibody
NB100-82245
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Western blot analysis of extract from mouse brain tissue using Tau (Ab-181) antibody ( Lane 1 and 2) and Tau (phospho-Thr181) antibody ( Lane 3 and 4).
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Analysis of extracts from mouse brain tissue using Tau(Phospho-Thr181) Antibody and the same antibody preincubated with blocking peptide.
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - PPP2R2C level regulates Tau phosphatase levels. Representative image of immunoblots of indicated antibodies are shown in SHSY5Y cell lines after knockdown and overexpression PPP2R2C. Image collected and cropped by CiteAb from the following publication (www.aging-us.com/lookup/doi/10.18632/aging.103048) licensed under a CC-BY licence.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
Noggin
[Unconjugated]
6057-NG/CF
Recombinant Human Noggin (Catalog # 6057-NG/CF) inhibits BMP-4 induced alkaline phosphatase production in the ATDC5 mouse chondrogenic cell line. The activity is approximately 30-fold greater than the top competitor's Noggin.
BG01V human embryonic stem cells were cultured in Mouse Embryonic Fibroblast Conditioned Media supplemented with FGF basic (5 ng/mL). Stem cells were driven into early cells of the neuroectoderm using a 3 day incubation in recombinant human Noggin (25 µg/mL) from either R&D Systems (Lot 1, Lot 2; Catalog # 6057-NG) or from two separate competitors (Competitor 1, Competitor 2). Control cells were not incubated in Noggin (No Noggin). The cells were stained for the early ectoderm marker, Otx2, and the neuroectoderm marker, SOX1. (A) Representative images of SOX1 (green), Otx2 (red), and DAPI (blue) staining in embryonic stem cells differentiated with Noggin from R&D Systems or Noggin from Competitor 2. (B) SOX1+ clusters were quantified under each of the indicated culture conditions. Cells treated with R&D Systems Noggin showed an increase in SOX1+ cells compared to both untreated and competitor-treated cells. R&D Systems Noggin showed consistent differentiation across the lots tested. BG01V human embryonic stem cells are licensed from ViaCyte, Inc.
(150 Publications)
Species: Hu
Applications: BA
TR
alpha/NR1A1/Thyroid H ...
NBP2-22523
Immunocytochemistry/Immunofluorescence: TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody [NBP2-22523] - Analysis of Thyroid Hormone Receptor alpha-2 (green) showing staining in the nucleus and cytoplasm of NIH-3T3 cells (right) compared to a negative control without primary antibody (left).
Immunocytochemistry/Immunofluorescence: TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody [NBP2-22523] - Analysis of Thyroid Hormone Receptor alpha-2 (green) showing staining in the nucleus and cytoplasm of C2C12 cells (right) compared to a negative control without primary antibody (left).
Immunocytochemistry/Immunofluorescence: TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody [NBP2-22523] - Analysis of Thyroid Hormone Receptor alpha-2 (green) showing staining in the nucleus and cytoplasm of A431 cells (right) compared to a negative control without primary antibody (left).
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Muscleblind-like 1
Antibody (3E7)
H00004154-M02
Western Blot: Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - MBNL1 monoclonal antibody (M02), clone 3E7 Analysis of MBNL1 expression in Hela S3 NE.
ELISA: Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - Detection limit for recombinant GST tagged MBNL1 is approximately 3ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: Muscleblind-like 1 Antibody (3E7) [H00004154-M02] - Analysis of monoclonal antibody to MBNL1 on HeLa cell. Antibody concentration 10 ug/ml.
(2 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Ataxin 1 Antibody
(2F5)
NBP1-51689
Western Blot: Ataxin 1 Antibody (2F5) [NBP1-51689] - Analysis using ATXN1 mab against HEK293 (1) and ATXN1 higGFC transfected HEK293 (2) cell lysate.
Flow Cytometry: Ataxin 1 Antibody (2F5) [NBP1-51689] - Flow cytometric analysis of Jurket cells using ATXN1 mouse mAb (green) and negative control (purple).
Immunohistochemistry-Paraffin: Ataxin 1 Antibody (2F5) [NBP1-51689] - Immunohistochemical analysis of paraffin-embedded ovarian cancer tissues (left) and lung cancer tissues (right) using ATXN1 mouse mAb with DAB staining.
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

SLC6A4/5-HTTLPR/Seroto ...
H00006532-D01P
Flow Cytometry: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Fixed and permeabilized mouse mast cells were stained for 1 hour in 4C then stained with PE secondary and ran on FACS. Image from verified customer review.
Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Analysis of SLC6A4 expression in transfected 293T cell line by SLC6A4 polyclonal antibody. Lane 1: SLC6A4 transfected lysate (70.30 KDa). Lane 2: Non-transfected lysate.
Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Analysis of SLC6A4 expression in mouse lung.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB
Cyclin A2 Antibody
NBP1-31330
Western Blot: Cyclin A2 Antibody [NBP1-31330] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Cyclin A2 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: Cyclin A2 Antibody [NBP1-31330] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Cyclin A2 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Cyclin A2 Antibody [NBP1-31330] - Detects Cyclin A2 protein at nucleus by immunofluorescent analysis.Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min.Green: Cyclin A2 stained by Cyclin A2 antibody diluted at 1:500.Red: phalloidin, a cytoskeleton marker, diluted at 1:100.Scale bar= 10 um.
(3 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
CNBP Antibody
(38F10) - BSA Free
NBP2-42632
Flow Cytometry: CNBP Antibody (38F10) [NBP2-42632] - Analysis of CNBP in MCF7 cell line, stainingat 2-5ug for 1x106cells (red line). The secondary antibodyused goat anti-mouse IgG Alexa fluor 488 conjugate. Isotypecontrol antibody was mouse IgG (black line).
Immunocytochemistry/Immunofluorescence: CNBP Antibody (38F10) [NBP2-42632] - Analysis in MCF7 cells line, stained with DAPI (Blue) for nucleus staining and monoclonal anti-human CNBP antibody (1:100) with goat anti-mouse IgG-Alexa fluor488 conjugate (Green).
Western Blot: CNBP Antibody (38F10) [NBP2-42632] - Analysis in Jurkat lysates.
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
BMP-4
[Unconjugated]
314-BP/CF
1 ug/lane of Recombinant Human BMP-4 was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 22-25 kDa and 37-41 kDa, respectively. Multiple bands in gel are due to variable glycosylation. 
Recombinant Human BMP-4 (Catalog #314-BP/CF) induces alkaline phosphatase production in the ATDC5 mouse chondrogenic cell line. The ED50 for this effect is 2.5-15 ng/mL.
(427 Publications)
Species: Hu
Applications: BA, BA
p97/VCP Antibody
(5)
NB120-11433
Western Blot: p97/VCP Antibody (5) [NB120-11433] - NKCC1 and KCC2 Expression in DLPFC. Expression of K-Cl cotransporter (KCC2) protein in the DLPFC in control subjects (CTL) and subjects with schizophrenia (SCZ) and in subjects with schizophrenia on and off medication for at least 6 weeks. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0123158), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: p97/VCP Antibody (5) [NB120-11433] - Both normal and cancer biopsies of deparaffinized Human brain tissue tissues.
Immunohistochemistry-Paraffin: p97/VCP Antibody (5) [NB120-11433] - Both normal and cancer biopsies of deparaffinized Human colon carcinoma tissues.
(1 Review)
(3 Publications)
Species: Hu, Pm, Mu, Rt, Ye
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
TNRC4 Antibody
NBP2-83704
TNRC4 Antibody
Species: Hu
Applications: WB

Publications for TNRC4 Antibody (NBP2-83704) (0)

There are no publications for TNRC4 Antibody (NBP2-83704).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNRC4 Antibody (NBP2-83704) (0)

There are no reviews for TNRC4 Antibody (NBP2-83704). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TNRC4 Antibody (NBP2-83704) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TNRC4 Products

Bioinformatics Tool for TNRC4 Antibody (NBP2-83704)

Discover related pathways, diseases and genes to TNRC4 Antibody (NBP2-83704). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNRC4 Antibody (NBP2-83704)

Discover more about diseases related to TNRC4 Antibody (NBP2-83704).
 

Pathways for TNRC4 Antibody (NBP2-83704)

View related products by pathway.

Research Areas for TNRC4 Antibody (NBP2-83704)

Find related products by research area.

Blogs on TNRC4

There are no specific blogs for TNRC4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TNRC4 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CELF3