New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

TNRC4 Antibody

Images

 
Western Blot: TNRC4 Antibody [NBP2-83704] - WB Suggested Anti-TNRC4 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Jurkat cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TNRC4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human TNRC4. Peptide sequence: MKEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGC The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CELF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TNRC4 Antibody

  • BRUNOL1CAG repeat protein 4
  • CAG/CTG 4
  • CAGH4CUG-BP- and ETR-3-like factor 3
  • CELF-3
  • CUGBP, Elav-like family member 3
  • ERDA4ELAV-type RNA-binding protein 1
  • ETR-1
  • MGC57297
  • TNRC4RNA-binding protein BRUNOL-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-316
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB110-85519
Species: Hu, Mu
Applications: ELISA, IHC, IP, KD, WB
NBP3-13106
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89932
Species: Hu
Applications: IHC, IHC-P
NBP2-16035
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB6967
Species: Hu
Applications: WB
NBP2-34062
Species: Hu
Applications: IHC, IHC-P, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
6057-NG/CF
Species: Hu
Applications: BA
NBP2-22523
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00004154-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00006532-D01P
Species: Hu, Mu
Applications: WB
NBP1-31330
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-42632
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
314-BP/CF
Species: Hu
Applications: BA, BA
NB120-11433
Species: Hu, Pm, Mu, Rt, Ye
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-83704
Species: Hu
Applications: WB

Publications for TNRC4 Antibody (NBP2-83704) (0)

There are no publications for TNRC4 Antibody (NBP2-83704).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNRC4 Antibody (NBP2-83704) (0)

There are no reviews for TNRC4 Antibody (NBP2-83704). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TNRC4 Antibody (NBP2-83704) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TNRC4 Products

Bioinformatics Tool for TNRC4 Antibody (NBP2-83704)

Discover related pathways, diseases and genes to TNRC4 Antibody (NBP2-83704). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNRC4 Antibody (NBP2-83704)

Discover more about diseases related to TNRC4 Antibody (NBP2-83704).
 

Pathways for TNRC4 Antibody (NBP2-83704)

View related products by pathway.

Research Areas for TNRC4 Antibody (NBP2-83704)

Find related products by research area.

Blogs on TNRC4

There are no specific blogs for TNRC4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TNRC4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CELF3