Home » TNPO2 » TNPO2 Proteins » Recombinant Human TNPO2 GST (N-Term) Protein

Recombinant Human TNPO2 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human TNPO2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 201-300 of Human TNPO2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDRAQALMDNIDTFIEHLFALAVDDDPEVRKNVCRALVMLLEVRIDRLIPHMHSIIQYMLQRTQDHDENVALEACEFWLTLAEQPICKEVLASHLVQLIP
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TNPO2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TNPO2 GST (N-Term) Protein

  • FLJ12155
  • IPO3
  • Karyopherin beta-2b
  • KPNB2Bimportin 3
  • transportin 2 (importin 3, karyopherin beta 2b)
  • transportin 2
  • transportin-2
  • TRN2karyopherin beta 2b, transportin

Background

TNPO2 - transportin 2 (importin 3, karyopherin beta 2b)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

HuR/ELAVL1
Antibody (4G8)
H00001994-M02
Western Blot: HuR/ELAVL1 Antibody (4G8) [H00001994-M02] - ELAVL1 monoclonal antibody (M02), clone 4G8 Analysis of ELAVL1 expression in HeLa.
Immunocytochemistry/Immunofluorescence: HuR/ELAVL1 Antibody (4G8) [H00001994-M02] - Analysis of monoclonal antibody to ELAVL1 on HeLa cell . Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: HuR/ELAVL1 Antibody (4G8) [H00001994-M02] - Analysis of monoclonal antibody to ELAVL1 on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.
(1 Review)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Transportin 1
Antibody (D45) - BSA
NB600-1397
Western Blot: Transportin 1 Antibody (D45) [NB600-1397] - Human lung cancer cell line usig lysates from HCC44 cell line. (N: Nuclear fraction, C: Cytoplasmic fraction). Image from verified customer review.
Western Blot: Transportin 1 Antibody (D45) [NB600-1397] - Whole cell protein from A431, Hek293 and MCF7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Transportin 1 (D45) in 1% milk, and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Paraffin: Transportin 1 Antibody (D45) [NB600-1397] - IHC analysis of a formalin fixed paraffin embedded tissue section of human pancreas using Transportin 1 antibody (clone D45) at 1:200 dilution. The antibody generated specific nuclear and cytoplasmic signal of Transportin 1 protein in the glandular cells while the connective tissue was largely negative.
(1 Review)
(6 Publications)
Species: Bv, Ca, Hu, Pm, Mu, Rb
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, WB
hnRNP A1 Antibody
(4B10) - BSA Free
NB100-672
Western Blot: hnRNP A1 Antibody (4B10) [NB100-672] - Cell line lysates were separated on SDS-PAGE and probed with 0.5 ug/mL Monoclonal Anti-hnRNP-A1 Clone: 4B10 (NB100-672). Lanes: 1-HeLa, 2-Jurkat, 3-HEK-293T, 4-WiDr, 5-NCI-H1299, 6-F9.
Knockdown Validated: hnRNP A1 Antibody (4B10) [NB100-672] - Western blot shows lysates of HEK293T human embryonic kidney parental cell line and hnRNP A1 knockout (KO) HEK293T cell line. PVDF membrane was probed with 0.5 ug/ml of Mouse Anti-Human hnRNP A1 Monoclonal Antibody (Catalog # NB100-672) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for hnRNP A1 at approximately 35 kDa (as indicated) in the parental HEK293T cell line, but is not detectable in the knockout HEK293T cell line. This experiment was conducted under reducing conditions.
Immunocytochemistry/Immunofluorescence: hnRNP A1 Antibody (4B10) [NB100-672] - The hnRNP A1 (4B10) antibody was tested in HeLa cells at a 1:200 dilution against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 568 (Red) and DAPI (Blue), respectively.
(21 Publications)
Species: Bv, Ca, Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, KD, MiAr, WB
eIF3K Antibody
NB100-93304
Western Blot: eIF3K Antibody [NB100-93304] - Detection of Human eIF3K/EIF3S12 on HeLa whole cell lysate using NB100-93304. eIF3K/EIF3S12 was also immunoprecipitated by rabbit anti-eIF3K/EIF3S12 antibody NB100-93303.
(5 Publications)
Species: ChHa, Hu
Applications: IP, WB
Napsin A Antibody
(TMU-Ad02)
NB110-68133
Immunohistochemistry-Paraffin: Napsin-A Antibody (TMU-Ad02) [NB110-68133] - Analysis of NAPSA on human lung adenocarcinoma using NB110-68133.
Western Blot: Napsin-A Antibody (TMU-Ad02) [NB110-68133] - Analysis of NAPSA expression in human lung using NB110-68133.
(1 Review)
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
NXF1 Antibody
NBP1-31649
Immunohistochemistry-Paraffin: NXF1 Antibody [NBP1-31649] - Paraffin-embedded NCIN87 Xenograft, using antibody at 1:100 dilution.
Western Blot: NXF1 Antibody [NBP1-31649] - Sample (30 ug of whole cell lysate) A: Hela B: Molt-4 7. 5% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: NXF1 Antibody [NBP1-31649] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CDKN3 Antibody
(OTI2E11)
NBP2-01245
Flow Cytometry: CDKN3 Antibody (2E11) [NBP2-01245] - Analysis of Jurkat cells, using anti-CDKN3 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: CDKN3 Antibody (2E11) [NBP2-01245] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-CDKN3 antibody, and then analyzed by flow cytometry.
Western Blot: CDKN3 Antibody (2E11) [NBP2-01245] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY CDKN3 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-CDKN3.
(1 Publication)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Ceruloplasmin
Antibody (6C3K9)
NBP3-15868
Immunohistochemistry-Paraffin: Ceruloplasmin Antibody (6C3K9) [NBP3-15868] - Rat liver using Ceruloplasmin Rabbit mAb (NBP3-15868) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Ceruloplasmin Antibody (6C3K9) [NBP3-15868] - Human liver using Ceruloplasmin Rabbit mAb (NBP3-15868) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry: Ceruloplasmin Antibody (6C3K9) [NBP3-15868] - Immunofluorescence analysis of rat liver using Ceruloplasmin Rabbit mAb (NBP3-15868) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MyoD Antibody
(5.8A) - BSA Free
NB100-56511
Immunocytochemistry/Immunofluorescence: MyoD Antibody (5.8A) [NB100-56511] - Cell Lines Tested: mouse skeletal muscle-derived primary cell population Test Sample Preparation: mouse skeletal muscle digested by collagenase type 2 System: Super Sensitive High Resolution Confocal Laser Microscope (LSM880 with Airyscan) Excitation Wavelength: 488nm Emission Filter: 562 nm. Image using the DyLight 488 form of this antibody. ICC/IF image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: MyoD Antibody (5.8A) [NB100-56511] - Human myoblasts were stained with MyoD1 antibody, diluted 1:200. ICC/IF image submitted by a verified customer review.
Western Blot: MyoD Antibody (5.8A) [NB100-56511] - Insuline-like growth factor (IGF1) antagonized the effects of miR-106a-5p on myogenic differentiation in C2C12. All data were collected from C2C12 myotubes 5 d post differentiation. Western-blot analysis of myogenic regulatory factors (MyoD, MyoG, MyHC) in cells; (H) The statistical results of Figure 3G. Data were presented as mean +/- SEM. n = 3 per group. * p < 0.05, ** p < 0.01. Image collected and cropped by CiteAb from the following publication (https://www.mdpi.com/2073-4425/9/7/333/htm) licensed under a CC-BY licence. anti-MyoG (catalog# NB100-56510)
(2 Reviews)
(23 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Myogenin Antibody
(5FD) - BSA Free
NB100-56510
Immunohistochemistry-Frozen: Myogenin Antibody (5FD) [NB100-56510] - Analysis of Myogenin in human alveolar rhabdomyosarcoma using NB100-56510 at 5 ug/mL.
Immunohistochemistry: Myogenin Antibody (5FD) [NB100-56510] - Human myocytes using NB100-56703 at 2.5 ug/mL. Hematoxylin-eosin counterstain.
Western Blot: Myogenin Antibody (5FD) [NB100-56510] - Analysis of Myogenin expression in various small-round cell tumor lines. The antibody strongly reacted with a band at ~34 kDa in alveolar rhobdomyosarcoma line (Rh30). Negative cell lines were PFSK-1, EB2, SK-N-SH, and SJSA-1.
(1 Review)
(10 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase‑3 was detected in immersion fixed paraffin-embedded sections of human colon cancer tissue using Rabbit Anti-Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Rabbit IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC003). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Caspase‑3 was detected in immersion fixed Jurkat human acute T cell leukemia cell line stimulated with staurosporin using Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (yellow; Catalog # NL004) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(7 Reviews)
(198 Publications)
Species: Hu, Mu
Applications: ICC, IHC
VEGF [HRP]
DVE00
(621 Publications)
Species: Hu
Applications: ELISA
Filamin B Antibody
NBP1-90286
Immunocytochemistry/Immunofluorescence: Filamin B Antibody [NBP1-90286] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol. Antibody staining is shown in green.
Western Blot: Filamin B Antibody [NBP1-90286] - Analysis in human cell lines A-549 and HEK293 using anti-FLNB antibody. Corresponding FLNB RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.
Immunohistochemistry-Paraffin: Filamin B Antibody [NBP1-90286] - Staining of human colon, placenta, prostate and skeletal muscle using Anti-Filamin B antibody NBP1-90286 (A) shows similar protein distribution across tissues to independent antibody NBP1-90285 (B).
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GAPDH Antibody
(1D4)
NB300-221
Western Blot: GAPDH Antibody (1D4) [NB300-221] - Analysis of cell line lysates probed with mouse mAb to GAPDH (theoretical molecular weight: 36 kDa), NB300-221, dilution 1:2,000: [1] protein standard, [2] HEK293, [3] HeLa, [4] SH-SY5Y, [5] COS1, [6] NIH-3T3, and [7] C6 cells. The GAPDH antibody reveals a single band at ~37 kDa in all cell lines. GAPDH is a house keeping protein, the level of which is relatively unaffected by most experimental manipulations, and, as a result, this antibody has been widely used as a western blotting loading control.
Immunocytochemistry/Immunofluorescence: GAPDH Antibody (1D4) [NB300-221] - Analysis of of HeLa cells stained with GAPDH antibody, dilution 1:100 (Green). DAPI staining of nuclear DNA (Blue). The GAPDHantibody produces strong cytoplasmic staining of healthy cells.
Immunocytochemistry/Immunofluorescence: GAPDH Antibody (1D4) [NB300-221] - SH-SY5Y cells stained with GAPDH antibody NB300-221 (green). Nuclear DNA is stained with Hoechst dye (blue).
(19 Reviews)
(366 Publications)
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
beta-Actin
Antibody (AC-15)
NB600-501
Western Blot: beta-Actin Antibody (AC-15) [NB600-501] - HEK293T cells transfected with Niaph virus Matrix Protein, expression 24h later. This image was submitted via customer review.
Simple Western: beta-Actin Antibody (AC-15) [NB600-501] - Analysis using the HRP conjugate of NB600-501. Electropherogram image(s) of corresponding Simple Western lane view. Beta-Actin antibody was used at 1:500 dilution on Hela, MCF-7, SH-SY5Y, & Jurkat lysate(s).
Western Blot: beta-Actin Antibody (AC-15) [NB600-501] - MMP-11 expression in oral cancer cell lines and the MMP-11 knockdown in SCC9 cells reduce cell migration. Western blot analysis showing the expression of MMP-11 protein in five oral cancer cell lines. Beta-Actin is included as a loading control. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0113129), licensed under a CC-BY licence.
(27 Reviews)
(516 Publications)
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
ACF Antibody
NBP1-90271
Western Blot: ACF Antibody [NBP1-90271] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: ACF Antibody [NBP1-90271] - Staining of human colon, kidney, liver and tonsil using Anti-A1CF antibody NBP1-90271 (A) shows similar protein distribution across tissues to independent antibody NBP2-33412 (B).
Immunohistochemistry-Paraffin: ACF Antibody [NBP1-90271] - Staining of human tonsil shows no positivity as expected.
Species: Hu
Applications: IHC, IHC-P, WB
CRM1 Antibody
NB100-79802
Immunohistochemistry-Paraffin: CRM1 Antibody [NB100-79802] - Human lung cancer. Antibody: Affinity purified rabbit anti-CRM1 used at a dilution of 1:5,000 (0.2ug/ml). Detection: DAB
Immunohistochemistry-Paraffin: CRM1 Antibody [NB100-79802] - Mouse teratoma. Antibody: Affinity purified rabbit anti-CRM1 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Immunocytochemistry/Immunofluorescence: CRM1 Antibody [NB100-79802] - Association between Nup98-HoxA9 and CRM1 is critical for the Hox Gene activation mediated by Nup98-HoxA9. Top panel: Nup98-HoxA9 interacts and sequesters CRM1 onto Nup98-HoxA9 dots. HeLa cells were transfected with the EGFP-Nup98-HoxA9 expressing plasmid. After 24 hr, cells were fixed and stained with an anti-CRM1 antibody. Arrows indicate the cells transfected. Bottom panel: Nup98-HoxA9 ES cells were fixed and co-stained with anti-FLAG (M2) and anti-CRM1 antibodies. Merged image of FLAG (green) and CRM1 (red) is shown. Bar, 5um. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/09540) licensed under a CC-BY licence.
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Recombinant Human
TNPO2 GST (N-Term) Pr ...
H00030000-Q01
Recombinant Human TNPO2 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for TNPO2 Partial Recombinant Protein (H00030000-Q01) (0)

There are no publications for TNPO2 Partial Recombinant Protein (H00030000-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNPO2 Partial Recombinant Protein (H00030000-Q01) (0)

There are no reviews for TNPO2 Partial Recombinant Protein (H00030000-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TNPO2 Partial Recombinant Protein (H00030000-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TNPO2 Products

Bioinformatics Tool for TNPO2 Partial Recombinant Protein (H00030000-Q01)

Discover related pathways, diseases and genes to TNPO2 Partial Recombinant Protein (H00030000-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNPO2 Partial Recombinant Protein (H00030000-Q01)

Discover more about diseases related to TNPO2 Partial Recombinant Protein (H00030000-Q01).
 

Pathways for TNPO2 Partial Recombinant Protein (H00030000-Q01)

View related products by pathway.

PTMs for TNPO2 Partial Recombinant Protein (H00030000-Q01)

Learn more about PTMs related to TNPO2 Partial Recombinant Protein (H00030000-Q01).

Blogs on TNPO2

There are no specific blogs for TNPO2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Western Blot: beta-Actin Antibody (AC-15) [NB600-501] - HEK293T cells transfected with Niaph virus Matrix Protein, expression 24h later. This image was submitted via customer review.
beta-Actin Antibody (AC-15)
NB600-501

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TNPO2 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol TNPO2