TNIP3 Antibody - BSA Free

Western Blot: TNIP3 Antibody [NBP2-85963] - WB Suggested Anti-TNIP3 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Lung

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TNIP3 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TNIP3. Peptide sequence: YERKVAELKTKLDAAERFLSTREKDPHQRQRKDDRQREDDRQRDLTRDRL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TNIP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TNIP3 Antibody - BSA Free

• A20
• A20-binding inhibitor of NF-kappa-B activation 3
• ABIN3
• ABIN-3ABIN-3 beta
• FLJ21162
• LINDListeria induced
• Listeria-induced gene protein
• TNFAIP3 interacting protein 3
• TNFAIP3-interacting protein 3 beta
• TNFAIP3-interacting protein 3
• TNIP3 beta

Background

TNIP3 binds to zinc finger protein TNFAIP3 and inhibits NF-kappa-B activation induced by tumor necrosis factor,Toll-like receptor 4 (TLR4), interleukin-1 and 12-O-tetradecanoylphorbol-13-acetate. Overexpression inhibitsNF-kappa-B-dependent gene expression in re

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TNIP3