TNIP2 Antibody


Immunocytochemistry/ Immunofluorescence: TNIP2 Antibody [NBP2-48949] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: TNIP2 Antibody [NBP2-48949] - Staining of human kidney shows cytoplasmic positivity in renal tubules.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

TNIP2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MLEQQILAYKDDFMSERADRERAQSRIQELEEKVASLLHQVSWRQDSREPDAGRIHAGSKTAKYLAADALELMVPGGWRP
Specificity of human TNIP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TNIP2 Recombinant Protein Antigen (NBP2-48949PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TNIP2 Antibody

  • A20-binding inhibitor of NF-kappa-B activation 2
  • A20-binding inhibitor of NF-kappaB activation-2
  • ABIN-2
  • Fetal liver LKB1-interacting protein
  • FLIP1DKFZp434J1313
  • MGC4289
  • TNFAIP3 interacting protein 2
  • TNFAIP3-interacting protein 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rb
Applications: WB, Flow, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
Species: Hu
Applications: WB, Simple Western, IHC, Block
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for TNIP2 Antibody (NBP2-48949) (0)

There are no publications for TNIP2 Antibody (NBP2-48949).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNIP2 Antibody (NBP2-48949) (0)

There are no reviews for TNIP2 Antibody (NBP2-48949). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TNIP2 Antibody (NBP2-48949) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for TNIP2 Antibody (NBP2-48949)

Discover related pathways, diseases and genes to TNIP2 Antibody (NBP2-48949). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNIP2 Antibody (NBP2-48949)

Discover more about diseases related to TNIP2 Antibody (NBP2-48949).

Pathways for TNIP2 Antibody (NBP2-48949)

View related products by pathway.

PTMs for TNIP2 Antibody (NBP2-48949)

Learn more about PTMs related to TNIP2 Antibody (NBP2-48949).

Blogs on TNIP2

There are no specific blogs for TNIP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TNIP2 Antibody and receive a gift card or discount.


Gene Symbol TNIP2