TMEPAI Antibody - BSA Free

Western Blot: TMEPAI Antibody [NBP2-56657] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: TMEPAI Antibody [NBP2-56657] - Staining of human cell line U-2 OS shows localization to vesicles.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TMEPAI Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VNSTAAAAAGQPNVSCTCNCKRSLFQSMEITELE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PMEPA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TMEPAI Recombinant Protein Antigen (NBP2-56657PEP)

Reactivity Notes

Mouse 88%, Rat 86%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TMEPAI Antibody - BSA Free

• prostate transmembrane protein, androgen induced 1
• Solid tumor-associated 1 protein
• STAG1prostate androgen induced RNA
• transmembrane prostate androgen-induced protein

Background

Interacts with the WW domains of NEDD4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PMEPA1