TMEM176A Antibody

Images

 
Western Blot: TMEM176A Antibody [NBP1-60015] - Human Stomach, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM176A Antibody Summary

Immunogen
Synthetic peptides corresponding to TMEM176A(transmembrane protein 176A) The peptide sequence was selected from the middle region of TMEM176A. Peptide sequence GYSYYNSACRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM176A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TMEM176A and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TMEM176A Antibody

  • GS188
  • HCA112Hepatocellular carcinoma-associated antigen 112
  • likley ortholog of mouse GS188
  • transmembrane protein 176A

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13446
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81689
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46539
Species: Hu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB110-61576
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, ICC/IF, IHC-P
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-2805
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF2796
Species: Hu
Applications: WB, IHC
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP1-80090
Species: Hu
Applications: WB

Publications for TMEM176A Antibody (NBP1-60015) (0)

There are no publications for TMEM176A Antibody (NBP1-60015).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM176A Antibody (NBP1-60015) (0)

There are no reviews for TMEM176A Antibody (NBP1-60015). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM176A Antibody (NBP1-60015) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM176A Products

Bioinformatics Tool for TMEM176A Antibody (NBP1-60015)

Discover related pathways, diseases and genes to TMEM176A Antibody (NBP1-60015). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM176A Antibody (NBP1-60015)

Discover more about diseases related to TMEM176A Antibody (NBP1-60015).
 

Pathways for TMEM176A Antibody (NBP1-60015)

View related products by pathway.

PTMs for TMEM176A Antibody (NBP1-60015)

Learn more about PTMs related to TMEM176A Antibody (NBP1-60015).

Blogs on TMEM176A

There are no specific blogs for TMEM176A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM176A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM176A
Uniprot