TMEM163 Antibody

Images

 
Western Blot: TMEM163 Antibody [NBP1-59478] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM163 Antibody Summary

Immunogen
Synthetic peptides corresponding to TMEM163(transmembrane protein 163) The peptide sequence was selected from the middle region of TMEM163. Peptide sequence AAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTRLLPEVDDFLFSV. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM163
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against TMEM163 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TMEM163 Antibody

  • DC29
  • DKFZp566N034
  • DKFZp666J217
  • FLJ30176
  • SV31
  • transmembrane protein 163

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-82245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
MAB660
Species: Hu
Applications: IHC
AF2156
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP1-32426
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NB100-2216
Species: Ch, Hu, Mu
Applications: ICC/IF, PAGE, WB
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB300-206
Species: Ba, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB600-1160
Species: Bv, Ca, Hu, Mu, Po, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
DBD00
Species: Hu
Applications: ELISA
AF1438
Species: Hu
Applications: IHC, WB
H00002629-M01
Species: Hu, Pl
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-59678
Species: Hu
Applications: WB
NBP1-84233
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81254
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-05767
Species: Ha, Hu, Mu, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP2-50028
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
NBP2-32398
Species: Hu
Applications: IHC, IHC-P

Publications for TMEM163 Antibody (NBP1-59478) (0)

There are no publications for TMEM163 Antibody (NBP1-59478).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM163 Antibody (NBP1-59478) (0)

There are no reviews for TMEM163 Antibody (NBP1-59478). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM163 Antibody (NBP1-59478) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM163 Products

Bioinformatics Tool for TMEM163 Antibody (NBP1-59478)

Discover related pathways, diseases and genes to TMEM163 Antibody (NBP1-59478). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM163 Antibody (NBP1-59478)

Discover more about diseases related to TMEM163 Antibody (NBP1-59478).
 

Pathways for TMEM163 Antibody (NBP1-59478)

View related products by pathway.

Blogs on TMEM163

There are no specific blogs for TMEM163, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM163 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM163
Uniprot