TMEM163 Antibody Summary
Immunogen |
Synthetic peptides corresponding to TMEM163(transmembrane protein 163) The peptide sequence was selected from the middle region of TMEM163.
Peptide sequence AAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTRLLPEVDDFLFSV. The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
TMEM163 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
This is a rabbit polyclonal antibody against TMEM163 and was validated on Western blot. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Purity |
Immunogen affinity purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for TMEM163 Antibody
Background
The function of this protein remains unknown.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: IHC
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Ch, Hu, Mu
Applications: ICC/IF, PAGE, WB
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Ba, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Bv, Ca, Hu, Mu, Po, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, WB
Species: Hu, Pl
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Publications for TMEM163 Antibody (NBP1-59478) (0)
There are no publications for TMEM163 Antibody (NBP1-59478).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TMEM163 Antibody (NBP1-59478) (0)
There are no reviews for TMEM163 Antibody (NBP1-59478).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TMEM163 Antibody (NBP1-59478) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TMEM163 Products
Bioinformatics Tool for TMEM163 Antibody (NBP1-59478)
Discover related pathways, diseases and genes to TMEM163 Antibody (NBP1-59478). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for TMEM163 Antibody (NBP1-59478)
Discover more about diseases related to TMEM163 Antibody (NBP1-59478).
| | Pathways for TMEM163 Antibody (NBP1-59478)
View related products by pathway.
|
Blogs on TMEM163