TMEM1 Antibody (5D5) - Azide and BSA Free

Western Blot: TMEM1 Antibody (5D5) [H00007109-M02] - TMEM1 monoclonal antibody (M02), clone 5D5. Analysis of TMEM1 expression in Hela S3 NE.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 5D5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TMEM1 Antibody (5D5) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: TMEM1 (NP_003265, 1162 a.a. ~ 1257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDDQPDSSSLKSRGSVHSACSSEHKGLPMPRLQALPAGQVFNSSSGTQVLVIPSQDDHVLEVS
• Specificity: TMEM1 - transmembrane protein 1 (5D5)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TRAPPC10
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TMEM1 Antibody (5D5) - Azide and BSA Free

• EHOC-1FLJ55683
• EHOC1GT334
• Epilepsy holoprosencephaly candidate 1 protein
• epilepsy holoprosencephaly candidate-1 protein
• FLJ54223
• FLJ54817
• Protein GT334
• TMEM1MGC126777
• trafficking protein particle complex 10
• trafficking protein particle complex subunit 10
• trafficking protein particle complex subunit 130
• Trafficking protein particle complex subunit TMEM1
• transmembrane protein 1
• Transport protein particle subunit TMEM1
• TRAPP 130 kDa subunit
• TRAPP subunit TMEM1
• TRS130
• TRS30

Background

The protein encoded by this gene is a transmembrane protein found in the cis-Golgi complex. The encoded protein is part of the multisubunit transport protein particle (TRAPP) complex and may be involved in vesicular transport from the endoplasmic reticulum to the Golgi. Mutations in this gene could be responsible for the Unverricht-Lundborg type of progressive myoclonus epilepsy, or for autoimmune polyglandular disease type 1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRAPPC10
• Entrez:
  • 7109(Human)
• Uniprot:
  • NP_003265(Human)