TMEFF2/Tomoregulin-2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TMEFF2/Tomoregulin-2 Antibody [NBP1-84362] - Immunofluorescent staining of human cell line U-2 OS shows localization to microtubules.
Immunohistochemistry-Paraffin: TMEFF2/Tomoregulin-2 Antibody [NBP1-84362] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEFF2/Tomoregulin-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEFF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TMEFF2/Tomoregulin-2 Protein (NBP1-84362PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEFF2/Tomoregulin-2 Antibody

  • CT120.2
  • HPP1member 2
  • Hyperplastic polyposis protein 1
  • TENB2
  • TMEFF2
  • Tomoregulin2
  • Tomoregulin-2
  • TPEFtomoregulin
  • TR-2
  • transmembrane protein TENB2
  • transmembrane protein with EGF-like and two follistatin-like domains 2
  • Transmembrane protein with EGF-like and two follistatin-like domains
  • TRtomoregulin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-58922
Species: Hu
Applications: WB
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF2009
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for TMEFF2/Tomoregulin-2 Antibody (NBP1-84362) (0)

There are no publications for TMEFF2/Tomoregulin-2 Antibody (NBP1-84362).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEFF2/Tomoregulin-2 Antibody (NBP1-84362) (0)

There are no reviews for TMEFF2/Tomoregulin-2 Antibody (NBP1-84362). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TMEFF2/Tomoregulin-2 Antibody (NBP1-84362) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEFF2/Tomoregulin-2 Products

Bioinformatics Tool for TMEFF2/Tomoregulin-2 Antibody (NBP1-84362)

Discover related pathways, diseases and genes to TMEFF2/Tomoregulin-2 Antibody (NBP1-84362). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEFF2/Tomoregulin-2 Antibody (NBP1-84362)

Discover more about diseases related to TMEFF2/Tomoregulin-2 Antibody (NBP1-84362).
 

Pathways for TMEFF2/Tomoregulin-2 Antibody (NBP1-84362)

View related products by pathway.

PTMs for TMEFF2/Tomoregulin-2 Antibody (NBP1-84362)

Learn more about PTMs related to TMEFF2/Tomoregulin-2 Antibody (NBP1-84362).

Blogs on TMEFF2/Tomoregulin-2

There are no specific blogs for TMEFF2/Tomoregulin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEFF2/Tomoregulin-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEFF2
Entrez