TM4SF1/L6 Antibody - BSA Free

Immunohistochemistry-Paraffin: TM4SF1/L6 Antibody [NBP1-82854] - Staining of human Ovarian cancer shows strong positivity in tumor cells.

Immunohistochemistry-Paraffin: TM4SF1/L6 Antibody [NBP1-82854] - Staining of human Breast shows moderate membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: TM4SF1/L6 Antibody [NBP1-82854] - Staining of human Fallopian tube shows moderate membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: TM4SF1/L6 Antibody [NBP1-82854] - Staining of human Lung shows moderate membranous positivity in pneumocytes.

Immunohistochemistry-Paraffin: TM4SF1/L6 Antibody [NBP1-82854] - Staining of human Skeletal muscle shows very weak membranous positivity in myocytes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TM4SF1/L6 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVSLFSI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TM4SF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TM4SF1/L6 Protein (NBP1-82854PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TM4SF1/L6 Antibody - BSA Free

• L6
• M3s1
• M3S1Tumor-associated antigen L6
• Membrane component chromosome 3 surface marker 1
• membrane component, chromosome 3, surface marker 1
• TAAL6
• TAAL6H-L6
• TM4SF1
• transmembrane 4 L six family member 1
• transmembrane 4 L6 family member 1
• transmembrane 4 superfamily member 1

Background

The protein encoded by the TM4SF1 gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface antigen and is highly expressed in different carcinomas. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TM4SF1
• Entrez:
  • 4071(Human)
• Uniprot:
  • P30408()