TM4SF1/L6 Antibody

Images

 
Immunohistochemistry-Paraffin: TM4SF1/L6 Antibody [NBP1-82854] - Staining of human fallopian tube shows moderate membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TM4SF1/L6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVSLFSI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TM4SF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TM4SF1/L6 Protein (NBP1-82854PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TM4SF1/L6 Antibody

  • L6
  • M3s1
  • M3S1Tumor-associated antigen L6
  • Membrane component chromosome 3 surface marker 1
  • membrane component, chromosome 3, surface marker 1
  • TAAL6
  • TAAL6H-L6
  • TM4SF1
  • transmembrane 4 L six family member 1
  • transmembrane 4 L6 family member 1
  • transmembrane 4 superfamily member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00058516-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-80104
Species: Hu
Applications: WB
NB100-2269
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-33832
Species: Hu
Applications: IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82854
Species: Hu
Applications: IHC, IHC-P

Publications for TM4SF1/L6 Antibody (NBP1-82854) (0)

There are no publications for TM4SF1/L6 Antibody (NBP1-82854).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TM4SF1/L6 Antibody (NBP1-82854) (0)

There are no reviews for TM4SF1/L6 Antibody (NBP1-82854). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TM4SF1/L6 Antibody (NBP1-82854) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TM4SF1/L6 Products

Bioinformatics Tool for TM4SF1/L6 Antibody (NBP1-82854)

Discover related pathways, diseases and genes to TM4SF1/L6 Antibody (NBP1-82854). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TM4SF1/L6 Antibody (NBP1-82854)

Discover more about diseases related to TM4SF1/L6 Antibody (NBP1-82854).
 

Pathways for TM4SF1/L6 Antibody (NBP1-82854)

View related products by pathway.

PTMs for TM4SF1/L6 Antibody (NBP1-82854)

Learn more about PTMs related to TM4SF1/L6 Antibody (NBP1-82854).

Blogs on TM4SF1/L6

There are no specific blogs for TM4SF1/L6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TM4SF1/L6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TM4SF1
Entrez
Uniprot