Recombinant Human TM2D3 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human TM2D3 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-221 of Human TM2D3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAGGVRPLRGLRALCRVLLFLSQFCILSGGESTEIPPYVMKCPSNGLCSRLPADCIDCTTNFSCTYGKPVTFDCAVKPSVTCVDQDFKSQKNFIINMTCRFCWQLPETDYECTNSTSCMTVSCPRQRYPANCTVRDHVHCLGNRTFPKMLYCNWTGGYKWSTALALSITLGGFGADRFYLGQWREGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGSLYI

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
TM2D3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
50.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TM2D3 GST (N-Term) Protein

  • BBP-like protein 2
  • BLP2Beta-amyloid-binding protein-like protein 2
  • FLJ22604
  • TM2 domain containing 3
  • TM2 domain-containing protein 3

Background

The protein encoded by this gene contains a structural module related to that of the seven transmembrane domain G protein-coupled receptor superfamily. This protein has sequence and structural similarities to the beta-amyloid binding protein (BBP), but, unlike BBP, it does not regulate a response to beta-amyloid peptide. This protein may have regulatory roles in cell death or proliferation signal cascades. Several alternatively spliced transcript variants of this gene are described but the full length nature of some variants has not been determined. Multiple polyadenylation sites have been found in this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM, KD
NBP1-33142
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13436
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
NBP2-66943
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15899
Species: Hu
Applications: WB, IHC, IHC-P
NB300-130
Species: Hu, Mu, Rt, Po, Bv, Ce, Ch, Dr, Eq, Pm, Pl, Ze
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01740
Species: Hu, Rt, Ca, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53210
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NB100-2136
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NBP2-67094
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20154
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00080213-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for TM2D3 Recombinant Protein (H00080213-P01) (0)

There are no publications for TM2D3 Recombinant Protein (H00080213-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TM2D3 Recombinant Protein (H00080213-P01) (0)

There are no reviews for TM2D3 Recombinant Protein (H00080213-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TM2D3 Recombinant Protein (H00080213-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional TM2D3 Products

Bioinformatics Tool for TM2D3 Recombinant Protein (H00080213-P01)

Discover related pathways, diseases and genes to TM2D3 Recombinant Protein (H00080213-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TM2D3 Recombinant Protein (H00080213-P01)

Discover more about diseases related to TM2D3 Recombinant Protein (H00080213-P01).
 

Pathways for TM2D3 Recombinant Protein (H00080213-P01)

View related products by pathway.

Blogs on TM2D3

There are no specific blogs for TM2D3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TM2D3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TM2D3