Home » Titin » Titin Antibodies » Titin Antibody

Titin Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Titin Antibody [NBP2-62600] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: Titin Antibody [NBP2-62600] - Staining of human skeletal muscle shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Titin Antibody [NBP2-62600] - Immunohistochemistry analysis in human skeletal muscle and liver tissues using Anti-TTN antibody. Corresponding TTN RNA-seq data ...read more
Immunohistochemistry-Paraffin: Titin Antibody [NBP2-62600] - Staining of human liver shows low expression as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Titin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTN
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Titin Antibody

  • cardiomyopathy, dilated 1G (autosomal dominant)
  • CMD1G
  • CMH9
  • CMPD4
  • connectin
  • DKFZp451N061
  • EC 2.7.11.1
  • EOMFC
  • FLJ32040
  • FLJ34413
  • FLJ39564
  • FLJ43066
  • HMERF
  • LGMD2JFLJ26020
  • MPRM
  • Rhabdomyosarcoma antigen MU-RMS-40.14
  • titin
  • TMDFLJ26409

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Myosin Heavy Chain
Antibody (MF20) [Unco ...
MAB4470
Myosin Heavy Chain was detected in immersion fixed C2C12 mouse myoblast cell line using Mouse Anti-Human Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counter­stained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Myosin Heavy Chain was detected in immersion fixed paraffin-embedded sections of human skeletal muscle using Mouse Anti-Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to sarcoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Myosin Heavy Chain was detected in perfusion fixed frozen sections of mouse skeletal muscle using Mouse Anti-Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to sarcoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(3 Reviews)
(38 Publications)
Species: Multi
Applications: WB, IHC, ICC
Nebulin Antibody
NBP1-87752
Immunohistochemistry-Paraffin: Nebulin Antibody [NBP1-87752] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: Nebulin Antibody [NBP1-87752] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: Nebulin Antibody [NBP1-87752] - Staining in human skeletal muscle and colon tissues using anti-NEB antibody. Corresponding NEB RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
Desmin Antibody
AF3844
Desmin was detected in immersion fixed frozen sections of mouse skeletal muscle using Human Desmin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3844) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to z-lines. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Desmin was detected in immersion fixed paraffin-embedded sections of human heart using 15 µg/mL Human Desmin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3844) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the sarcoplasm of cardiomyocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(13 Publications)
Species: Hu, Mu
Applications: IHC
Calpain 3 Antibody
NBP2-34061
Immunohistochemistry-Paraffin: Calpain 3 Antibody [NBP2-34061] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: Calpain 3 Antibody [NBP2-34061] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Calpain 3 Antibody [NBP2-34061] - Staining in human skeletal muscle and pancreas tissues using anti-CAPN3 antibody. Corresponding CAPN3 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
TCAP Antibody
NBP1-85544
Western Blot: TCAP Antibody [NBP1-85544] - Analysis in control (vector only transfected HEK293T lysate) and TCAP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: TCAP Antibody [NBP1-85544] - Staining of human heart muscle shows distinct cytoplasmic positivity.
Species: Hu
Applications: WB, IHC, IHC-P
Fibronectin
Antibody
NBP1-91258
Western Blot: Fibronectin Antibody [NBP1-91258] - Analysis of Fibronectin in NIH 3T3 cell lysate.
Immunocytochemistry/Immunofluorescence: Fibronectin Antibody [NBP1-91258] - NIH-3T3 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-Fibronectin at 2 ug/mL overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at 1:500. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at 1:1000 and detected with an anti-mouse DyLight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Analysis in a 6 month old Alport mouse kidney. Image from a verified customer review.
(9 Reviews)
(20 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
OBSCN Antibody
NBP1-88818
Immunocytochemistry/Immunofluorescence: OBSCN Antibody [NBP1-88818] - Staining of human cell line A-431 shows localization to nuclear bodies, plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: OBSCN Antibody [NBP1-88818] - Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: OBSCN Antibody [NBP1-88818] - Staining of human liver shows low expression as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining in human skeletal muscle and tonsil tissues. Corresponding DMD RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human heart muscle shows strong membranous positivity in myocytes.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human skeletal muscle shows strong membranous positivity in myocytes.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
ANKRD1 Antibody
NBP2-14292
Immunocytochemistry/Immunofluorescence: ANKRD1 Antibody [NBP2-14292] - Staining of human cell line U-2 OS shows localization to nucleoli fibrillar center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ANKRD1 Antibody [NBP2-14292] - Staining in human heart muscle and testis tissues. Corresponding ANKRD1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ANKRD1 Antibody [NBP2-14292] - Staining of human heart shows moderate cytoplasmic positivity in cardiomyocytes.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Afamin Antibody
NBP1-89156
Immunohistochemistry-Paraffin: Afamin Antibody [NBP1-89156] - Staining of human kidney.
Immunohistochemistry: Afamin Antibody [NBP1-89156] - Staining of human kidney shows strong cytoplasmic and extracellular material positivity in cells in tubules.
Immunohistochemistry-Paraffin: Afamin Antibody [NBP1-89156] - Staining of human duodenum shows strong plasma positivity.
Species: Hu
Applications: IHC, IHC-P
KCNT1 Antibody
NBP2-32496
Immunohistochemistry-Paraffin: KCNT1 Antibody [NBP2-32496] - Staining of human stomach, upper shows strong membranous positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P
Vinculin Antibody
(hVIN-1)
NB600-1293
Immunocytochemistry/Immunofluorescence: Vinculin Antibody (hVIN-1) [NB600-1293] - Mouse primary keratinocytes stained with the clone hVIN-1. Image is courtesy of customer review.
Immunocytochemistry/Immunofluorescence: Vinculin Antibody (hVIN-1) [NB600-1293] - MCF7 breast carcinoma cells expressing GFP fused CIN85 were labeled at a 1:400 dilution.
Immunocytochemistry/Immunofluorescence: Vinculin Antibody (hVIN-1) [NB600-1293] - Primary human osteoblast cells labeled (red), actin was stained with Phalloidin (green) and nuclei stained blue.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr, ICC
MHC Class I
Antibody (OX18)
NB120-6405
Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - PC-12 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-MHC Class I (OX18) NB120-6405 at a 1:100 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: MHC Class I Antibody (OX18) [NB120-6405] - Analysis of FFPE rat brain cerebellum using MHC Class I (OK18) antibody at 1:200 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Endothelial staining was observed. Staining was performed by Histowiz.
Flow Cytometry: MHC Class I Antibody (OX18) [NB120-6405] - Analysis using the FITC conjugate of NB120-6405. Staining of rat spleen cells with mouse anti-rat RT1-A (OX18).
(29 Publications)
Species: Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
CSRP3 Antibody
NBP1-06983
Western Blot: CSRP3 Antibody [NBP1-06983] - (0.01ug/ml) staining of Human (A), Mouse (B) and Rat (C) Heart lysate (35ug protein in RIPA buffer). Detected by chemiluminescence.
Immunohistochemistry-Paraffin: CSRP3 Antibody [NBP1-06983] - staining of paraffin embedded Human Heart. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: CSRP3 Antibody [NBP1-06983] - Staining of paraffin embedded Human Skeletal Muscle. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P, IP, PEP-ELISA
Gelsolin/GSN
Antibody
NBP1-33177
Western Blot: Gelsolin/GSN Antibody [NBP1-33177] - Non-transfected (-) and transfected (+) HeLa whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with Gelsolin antibody [C2C3], C-term.
Immunocytochemistry/Immunofluorescence: Gelsolin/GSN Antibody [NBP1-33177] - Methanol-fixed HeLa, using Gelsolin antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled with Red at 1:2000.
Immunohistochemistry-Paraffin: Gelsolin/GSN Antibody [NBP1-33177] - H1299 xenograft, using Gelsolin antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Ryanodine Receptor
1 Antibody (34C)
NB300-543
Immunohistochemistry-Paraffin: Ryanodine Receptor 1 Antibody (34C) [NB300-543] - Biopsies of deparaffinized Human skeletal muscle tissue.
(12 Publications)
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, IF
Calpain 3 Antibody
NBP2-34061
Immunohistochemistry-Paraffin: Calpain 3 Antibody [NBP2-34061] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: Calpain 3 Antibody [NBP2-34061] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Calpain 3 Antibody [NBP2-34061] - Staining in human skeletal muscle and pancreas tissues using anti-CAPN3 antibody. Corresponding CAPN3 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
Ryanodine Receptor
2 Antibody
NBP2-76961
Immunocytochemistry/Immunofluorescence: Ryanodine Receptor 2 Antibody [NBP2-76961] - ICC staining RYR2 in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry: Ryanodine Receptor 2 Antibody [NBP2-76961] - Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue using anti-RYR2 antibody. Counter stained with hematoxylin.
Flow Cytometry: Ryanodine Receptor 2 Antibody [NBP2-76961] - Flow cytometric analysis of 293T cells with RYR2 antibody at 1/100 dilution (fuchsia) compared with an unlabelled control (cells without incubation with primary antibody; yellow). Alexa Fluor 488-conjugated goat anti-rabbit IgG was used as the secondary antibody.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC
Vimentin Antibody
NB300-223
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Human A7 cells. Cells were fixed with 10% formalin and permeabilized with 0.1% TritonX-100. After blocking, cells were incubated with primary antibody (1:600) at 4C O/N followed with Alexa Fluor 488 labeled secondary antibody and counterstained with DAPI and Phalloidin for nuclei and F-actin respectively. Imaged with Leica TCS SP5 confocal microscope. Image from verified customer review.
Immunohistochemistry-Frozen: Vimentin Antibody [NB300-223] - 10 um Cryosections from PFA fixed murine brain acute slices stained with Vimentin antibody (1:600) and Alexa Fluor 488 anti chicken IgG. Antibody showed specific staining, also of blood vessels. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Analysis of HeLa cell culture. Antibody at 1:10,000 in green, and costained with mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
(5 Reviews)
(31 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Titin Antibody
NBP2-62600
Titin Antibody
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for Titin Antibody (NBP2-62600) (0)

There are no publications for Titin Antibody (NBP2-62600).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Titin Antibody (NBP2-62600) (0)

There are no reviews for Titin Antibody (NBP2-62600). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Titin Antibody (NBP2-62600) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Titin Products

Array NBP2-62600

Bioinformatics Tool for Titin Antibody (NBP2-62600)

Discover related pathways, diseases and genes to Titin Antibody (NBP2-62600). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Titin Antibody (NBP2-62600)

Discover more about diseases related to Titin Antibody (NBP2-62600).
 

Pathways for Titin Antibody (NBP2-62600)

View related products by pathway.

PTMs for Titin Antibody (NBP2-62600)

Learn more about PTMs related to Titin Antibody (NBP2-62600).
 

Research Areas for Titin Antibody (NBP2-62600)

Find related products by research area.

Blogs on Titin

There are no specific blogs for Titin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Titin Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TTN