Home » Titin » Titin Antibodies » Titin Antibody

Titin Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Titin Antibody [NBP2-62600] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: Titin Antibody [NBP2-62600] - Staining of human skeletal muscle shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Titin Antibody [NBP2-62600] - Immunohistochemistry analysis in human skeletal muscle and liver tissues using Anti-TTN antibody. Corresponding TTN RNA-seq data ...read more
Immunohistochemistry-Paraffin: Titin Antibody [NBP2-62600] - Staining of human liver shows low expression as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Titin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMK
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTN
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Titin Recombinant Protein Antigen (NBP2-62600PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Titin Antibody

  • cardiomyopathy, dilated 1G (autosomal dominant)
  • CMD1G
  • CMH9
  • CMPD4
  • connectin
  • DKFZp451N061
  • EC 2.7.11.1
  • EOMFC
  • FLJ32040
  • FLJ34413
  • FLJ39564
  • FLJ43066
  • HMERF
  • LGMD2JFLJ26020
  • MPRM
  • Rhabdomyosarcoma antigen MU-RMS-40.14
  • titin
  • TMDFLJ26409

Background

Monoclonal Anti-Titin can be used for study of the elastic filaments within sarcomeric structures. It is also useful as a differentiation marker in the separation of rhabdomyosarcomas from other muscle tumors.By indirect immunofluorescence the antibody displays a typical striated staining pattern on frozen sections of chicken skeletal and cardiac muscle tissues. Stains the region of the A-I junction by indirect immunofluorescence. It shows a decoration line 0.05 mm from the end of the A band in electron micro-graphs.In immunoblotting, using total extracts of chicken breast muscle, the antibody reacts specifically with both bands of the titin double and shows no reaction with nebulin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Myosin Heavy Chain
Antibody (MF20) [Unco ...
MAB4470
Myosin Heavy Chain was detected in immersion fixed paraffin-embedded sections of human skeletal muscle using Mouse Anti-Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to sarcoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Myosin Heavy Chain was detected in perfusion fixed frozen sections of mouse skeletal muscle using Mouse Anti-Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to sarcoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Myosin Heavy Chain was detected in immersion fixed C2C12 mouse myoblast cell line using Mouse Anti-Human Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counter­stained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
(81 Publications)
Species: All-Multi
Applications: ICC, IHC, WB
Nebulin Antibody
(NB2)
NB120-11099
Immunohistochemistry: Nebulin Antibody (NB2) [NB120-11099] - Frozen sections, acetone fixed Chicken cardiac muscle were stained with 1:400 Monoclonal Anti-Nebulin antibody produced in Mouse, Clone: NB2. followed by 1:40 Anti-Mouse IgG (Fab specific)-FITC antibody produced in Goat.
(1 Publication)
Species: Al, Am, Av, Bv, Ch, Fi, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, WB
Desmin Antibody
AF3844
Desmin was detected in immersion fixed frozen sections of mouse skeletal muscle using Human Desmin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3844) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to z-lines. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Desmin was detected in immersion fixed paraffin-embedded sections of human heart using 15 µg/mL Human Desmin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3844) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the sarcoplasm of cardiomyocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(16 Publications)
Species: Hu, Mu
Applications: IHC
Calpain 3 Antibody
NBP1-31756
Immunocytochemistry/Immunofluorescence: Calpain 3 Antibody [NBP1-31756] - Analysis of methanol-fixed HeLa, using antibody at 1:200 dilution.
Western Blot: Calpain 3 Antibody [NBP1-31756] - Sample (30 ug of whole cell lysate) A: Molt-4 10% SDS PAGE; antibody diluted at 1:1000.
Species: Hu
Applications: ICC/IF, WB
TCAP Antibody
NBP1-85544
Western Blot: TCAP Antibody [NBP1-85544] - Analysis in control (vector only transfected HEK293T lysate) and TCAP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: TCAP Antibody [NBP1-85544] - Analysis in human skeletal muscle tissue.
Immunohistochemistry-Paraffin: TCAP Antibody [NBP1-85544] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
Species: Hu
Applications: IHC, IHC-P, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Feline corneal stromal cells. IHC-Fr and IF (Alexa Fluor488) were performed using NBP1-91258 at 1:400. Image captured by epifluorescent microscopy. Image from verified customer review.
Western Blot: Fibronectin Antibody [NBP1-91258] - Analysis of Fibronectin in HepG2 cell lysate.
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Trabecular meshwork (TM) region of pig eyes. NBP1-91258 Fibronectin antibody was labelled with Alexa Fluor 488 conjugated secondary antibody (Green). DAPI shown as blue. Image from verified customer review.
(11 Reviews)
(40 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
OBSCN Antibody
NBP1-88818
Immunohistochemistry-Paraffin: OBSCN Antibody [NBP1-88818] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: OBSCN Antibody [NBP1-88818] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: OBSCN Antibody [NBP1-88818] - Analysis in human skeletal muscle and liver tissues. Corresponding OBSCN RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human heart muscle shows strong membranous positivity in myocytes.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human skeletal muscle shows strong membranous positivity in myocytes.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human tonsil shows no positivity as expected.
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
ANKRD1 Antibody
NBP2-15397
Immunocytochemistry/Immunofluorescence: ANKRD1 Antibody [NBP2-15397] - Paraformaldehyde-fixed A431, using antibody at 1:200 dilution.
Western Blot: ANKRD1 Antibody [NBP2-15397] - Sample (50 ug of whole cell lysate) A: mouse heart 10% SDS PAGE; antibody diluted at 1:1000.
Western Blot: ANKRD1 Antibody [NBP2-15397] - Sample (30 ug of whole cell lysate) A: A431 B: Jurkat 10% SDS PAGE; antibody diluted at 1:1000.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Afamin Antibody
NBP2-15304
Immunocytochemistry/Immunofluorescence: Afamin Antibody [NBP2-15304] - Analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: Afamin Antibody [NBP2-15304] - Paraffin-embedded Cal27 xenograft, using antibody at 1:500 dilution.
Western Blot: Afamin Antibody [NBP2-15304] - Sample (30 ug of whole cell lysate) A: NIH-3T3 B: JC C: BCL-1 7. 5% SDS PAGE; antibody diluted at 1:5000.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
KCNT1 Antibody
NBP2-80516
KCNT1 Antibody
Species: Mu, Rt
Applications: IHC, IHC-P, WB
Vinculin Antibody
(728526) [Unconjugate ...
MAB6896
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and PC‑3 human prostate cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for Vinculin at approximately 122 kDa (as indicated) using 20 µg/mL of Mouse Anti-Human/Mouse/Rat Vinculin Monoclonal Antibody (Catalog # MAB6896). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and HepG2 human hepatocellular carcinoma cell line. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human Vinculin Monoclonal Antibody (Catalog # MAB6896) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Vinculin at approximately 124 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Vinculin was detected in immersion fixed paraffin-embedded sections of human uterus using Mouse Anti-Human Vinculin Monoclonal Antibody (Catalog # MAB6896) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to smooth muscle cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Reviews)
(12 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
MHC Class I
Antibody (OX18) - BSA
NB120-6405
Flow Cytometry: MHC Class I Antibody (OX18) [NB120-6405] - Analysis using the FITC conjugate of NB120-6405. Staining of rat spleen cells with mouse anti-rat RT1-A (OX18).
Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - PC12 cells were fixed for 10 minutes using 4% PFA and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-MHC Class I Antibody (OX18) at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - Major histocompatibility complex (MHC) I and II as well as Transporter associated with antigen presentation II (TAPII) were analyzed, using immunocytochemistry on rat Schwann cells (SCs). Corresponding merges are shown in the bottom rows. Treatment of SCs with IL-17 was performed at concentrations of 0.5 and 50 ng/mL. Graphs to the right show densitometry quantification. SCs showed expression of MHCI > TAPII > MHCII, which increased after IL-17 treatment. MHCI was mainly detected in the cytoplasm and the expression increased in a dose-dependent manner after IL-17 treatment, significant for 0.5 ng/mL and 50 ng/mL (**P <=0.01). Image collected and cropped by CiteAb from the following publication (http://jneuroinflammation.biomedcentral.com/articles/10.1186/1742-2094-11-63), licensed under a CC-BY licence.
(33 Publications)
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
CSRP3 Antibody
NBP1-06983
Western Blot: CSRP3 Antibody [NBP1-06983] - (0.01ug/ml) staining of Human (A), Mouse (B) and Rat (C) Heart lysate (35ug protein in RIPA buffer). Detected by chemiluminescence.
Immunohistochemistry-Paraffin: CSRP3 Antibody [NBP1-06983] - Staining of paraffin embedded Human Skeletal Muscle. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: CSRP3 Antibody [NBP1-06983] - staining of paraffin embedded Human Heart. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
Gelsolin/GSN
Antibody
NBP1-33177
Immunocytochemistry/Immunofluorescence: Gelsolin/GSN Antibody [NBP1-33177] - Methanol-fixed HeLa, using Gelsolin antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled with Red at 1:2000.
Immunohistochemistry-Paraffin: Gelsolin/GSN Antibody [NBP1-33177] - H1299 xenograft, using Gelsolin antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min
Western Blot: Gelsolin/GSN Antibody [NBP1-33177] - Sample (30 ug of whole cell lysate) A: H1299 B: Hela 7.5% SDS PAGE; antibody diluted at 1:1000.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Ryanodine Receptor
Antibody (34C) - BSA ...
NB300-543
Immunohistochemistry-Paraffin: Ryanodine Receptor Antibody (34C) [NB300-543] - Biopsies of deparaffinized Human skeletal muscle tissue.
(12 Publications)
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Calpain 3 Antibody
NBP1-31756
Immunocytochemistry/Immunofluorescence: Calpain 3 Antibody [NBP1-31756] - Analysis of methanol-fixed HeLa, using antibody at 1:200 dilution.
Western Blot: Calpain 3 Antibody [NBP1-31756] - Sample (30 ug of whole cell lysate) A: Molt-4 10% SDS PAGE; antibody diluted at 1:1000.
Species: Hu
Applications: ICC/IF, WB
Ryanodine Receptor
2 Antibody
NBP1-90091
Immunohistochemistry-Paraffin: Ryanodine Receptor 2 Antibody [NBP1-90091] - Analysis in human heart muscle and liver tissues. Corresponding RYR2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Ryanodine Receptor 2 Antibody [NBP1-90091] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Ryanodine Receptor 2 Antibody [NBP1-90091] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P
Vimentin Antibody
NB300-223
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Analysis of HeLa cell culture. Antibody at 1:10,000 in green, and costained with mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
Immunohistochemistry-Frozen: Vimentin Antibody [NB300-223] - 10 um Cryosections from PFA fixed murine brain acute slices stained with Vimentin antibody (1:600) and Alexa Fluor 488 anti chicken IgG. Antibody showed specific staining, also of blood vessels. IHC-Fr image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Human A7 cells. Cells were fixed with 10% formalin and permeabilized with 0.1% TritonX-100. After blocking, cells were incubated with primary antibody (1:600) at 4C O/N followed with Alexa Fluor 488 labeled secondary antibody and counterstained with DAPI and Phalloidin for nuclei and F-actin respectively. Imaged with Leica TCS SP5 confocal microscope. ICC/IF image submitted by a verified customer review.
(6 Reviews)
(55 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Titin Antibody
NBP2-62600
Titin Antibody
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for Titin Antibody (NBP2-62600) (0)

There are no publications for Titin Antibody (NBP2-62600).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Titin Antibody (NBP2-62600) (0)

There are no reviews for Titin Antibody (NBP2-62600). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Titin Antibody (NBP2-62600) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Titin Products

Array NBP2-62600

Bioinformatics Tool for Titin Antibody (NBP2-62600)

Discover related pathways, diseases and genes to Titin Antibody (NBP2-62600). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Titin Antibody (NBP2-62600)

Discover more about diseases related to Titin Antibody (NBP2-62600).
 

Pathways for Titin Antibody (NBP2-62600)

View related products by pathway.

PTMs for Titin Antibody (NBP2-62600)

Learn more about PTMs related to Titin Antibody (NBP2-62600).
 

Research Areas for Titin Antibody (NBP2-62600)

Find related products by research area.

Blogs on Titin

There are no specific blogs for Titin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Titin Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TTN