TIP120A Antibody

Images

 
Western Blot: TIP120A Antibody [NBP2-55510] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: TIP120A Antibody [NBP2-55510] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & the Golgi apparatus.
Independent Antibodies: Western Blot: TIP120A Antibody [NBP2-55510] - Analysis using Anti-CAND1 antibody NBP2-55510 (A) shows similar pattern to independent antibody NBP2-38974 (B).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

TIP120A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCT
Specificity
Specificity of human TIP120A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CAND1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TIP120A Recombinant Protein Antigen (NBP2-55510PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TIP120A Antibody

  • cullin-associated and neddylation-dissociated 1
  • Cullin-associated and neddylation-dissociated protein 1
  • cullin-associated NEDD8-dissociated protein 1
  • DKFZp434M1414
  • FLJ90441
  • KIAA0829FLJ10114
  • p120 CAND1
  • TBP interacting protein
  • TBP-interacting protein 120A
  • TBP-interacting protein of 120 kDa A
  • TIP120AFLJ38691
  • TIP120FLJ10929

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75458
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-75643
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD
H00010920-B01P
Species: Hu, Rt
Applications: WB, ICC/IF
AF2769
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-78048
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-76825
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-49142
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-75459
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-55510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for TIP120A Antibody (NBP2-55510) (0)

There are no publications for TIP120A Antibody (NBP2-55510).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIP120A Antibody (NBP2-55510) (0)

There are no reviews for TIP120A Antibody (NBP2-55510). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TIP120A Antibody (NBP2-55510) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TIP120A Products

Bioinformatics Tool for TIP120A Antibody (NBP2-55510)

Discover related pathways, diseases and genes to TIP120A Antibody (NBP2-55510). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIP120A Antibody (NBP2-55510)

Discover more about diseases related to TIP120A Antibody (NBP2-55510).
 

Pathways for TIP120A Antibody (NBP2-55510)

View related products by pathway.

PTMs for TIP120A Antibody (NBP2-55510)

Learn more about PTMs related to TIP120A Antibody (NBP2-55510).

Blogs on TIP120A

There are no specific blogs for TIP120A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIP120A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CAND1