| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 8E5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse TIMM8B Antibody (8E5) - Azide and BSA Free (H00026521-M15) is a monoclonal antibody validated for use in WB and ELISA. Anti-TIMM8B Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | TIMM8B (NP_036591.1, 1 a.a. ~ 83 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TIMM8B |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody is useful for ELISA, Western Blot |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00026521-M15 | Applications | Species |
|---|---|---|
| Del Puerto-Nevado L, Santiago-Hernandez A, Solanes-Casado S et al. Diabetes-mediated promotion of colon mucosa carcinogenesis is associated with mitochondrial dysfunction Mol Oncol 2019-06-14 [PMID: 31199051] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for TIMM8B Antibody (H00026521-M15)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.