TIMM8B Antibody (8E5) - Azide and BSA Free

Western Blot: TIMM8B Antibody (8E5) [H00026521-M15] - Analysis of TIMM8B expression in transfected 293T cell line by TIMM8B monoclonal antibody (M15), clone 8E5. Lane 1: TIMM8B transfected lysatE (9.3 KDa). Lane 2: Non-transfected lysate.

Western Blot: TIMM8B Antibody (8E5) [H00026521-M15] - Western blot analysis of TIMM8B from in vitro experiments using a normal colon mucosa epithelial cell line exposed to high (HG) or NG condition. Relative densitometric quantification and representative immunoblots are shown. CO: (osmotic) control. Error bars indicate SEM. Mann-Whitney statistical U-test used with three biologically independent replicates included (*P-value < 0.05). Image collected and cropped by CiteAb from the following publication (//onlinelibrary.wiley.com/doi/abs/10.1002/1878-0261.12531), licensed under a CC-BY license.

ELISA: TIMM8B Antibody (8E5) [H00026521-M15] - Detection limit for recombinant GST tagged TIMM8B is 0.3 ng/ml as a capture antibody.

Western blot analysis of MRPL18 (A), TIMM8B (B), and EIF1A (C) from in vitro experiments using a normal colon mucosa epithelial cell line exposed to high (HG) or NG condition. Relative densitometric quantification and representative immunoblots are shown. CO: (osmotic) control. Error bars indicate SEM. Mann–Whitney statistical U‐test used with three biologically independent replicates included (*P‐value < 0.05).

Western Blot: TIMM8B Antibody (8E5) [H00026521-M15] - Western blot analysis of MRPL18 (A), TIMM8B (B), & EIF1A (C) from in vitro experiments using a normal colon mucosa epithelial cell line exposed to high (HG) or NG condition. Relative densitometric quantification & representative immunoblots are shown. CO: (osmotic) control. Error bars indicate SEM. Mann–Whitney statistical U‐test used with three biologically independent replicates included (*P‐value < 0.05). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31199051), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 8E5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TIMM8B Antibody (8E5) - Azide and BSA Free Summary

• Immunogen: TIMM8B (NP_036591.1, 1 a.a. ~ 83 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TIMM8B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: This antibody is useful for ELISA, Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TIMM8B Antibody (8E5) - Azide and BSA Free

• DDP2DDP-like protein
• DDPL
• Deafness dystonia protein 2
• FLJ21744
• MGC102866
• MGC117373
• mitochondrial import inner membrane translocase subunit Tim8 B
• TIM8Btranslocase of inner mitochondrial membrane 8 (yeast) homolog B
• translocase of inner mitochondrial membrane 8 homolog B (yeast)

Background

TIMM8B belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TIMM8B Antibody (H00026521-M15)(1)

Publication using H00026521-M15

• Del Puerto-Nevado L, Santiago-Hernandez A, Solanes-Casado S et al. Diabetes-mediated promotion of colon mucosa carcinogenesis is associated with mitochondrial dysfunction Mol Oncol 2019-06-14 [PMID: 31199051] (WB, Human)

Bioinformatics

• Gene Symbol: TIMM8B
• Uniprot:
  • NP_036591(Human)